KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0504Help
Entry
LPST_C0504        CDS       T01324                                 

Gene name
dut
Definition
trimetaphosphatase
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPST_C0504 (dut)
Enzymes [BR:lps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     LPST_C0504 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543031..543567
Genome map
AA seq 178 aa AA seqDB search
MARGFEIVSQYAQAGLHVPYRTTKQAAGYDFEAAEDFTLPSIWKMNFIKVLWQIHHGETS
SAADLDAAAKVLKPWLVPTGIKAFMNEGEYLLLANRSSNPLKRNLILPNGIGVIDADYYN
NPKNEGAIFVQLINMGIRDVHIKKGERIAQGIFTPYLTVTDETNVTTTRSGGFGSTNK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcacggggatttgaaattgtaagtcaatacgcgcaggcggggttacatgtaccttac
cgcaccaccaagcaagcagctggctatgacttcgaagcggcggaagattttacgttaccg
tcaatttggaaaatgaactttatcaaagtactttggcaaatacatcatggtgaaacgagt
tctgcagccgatttggatgcggcggctaaagtccttaaaccatggcttgttccaacgggt
attaaggcatttatgaatgaaggtgaatacttactattagccaatcgttccagcaacccc
ttgaagcgtaacttgattctaccgaatgggattggcgtcattgacgctgactactataac
aatcccaagaatgaaggcgcgatttttgtccaattaatcaacatggggattcgcgacgtt
cacattaaaaagggtgaacgcattgcccaagggatttttaccccttatctgactgttacg
gatgaaacgaatgtgacaacgacacgttctgggggcttcggttcgaccaataaatag

DBGET integrated database retrieval system