KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0532Help
Entry
LPST_C0532        CDS       T01324                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LPST_C0532 (recR)
DNA repair and recombination proteins [BR:lps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LPST_C0532 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571181..571780
Genome map
AA seq 199 aa AA seqDB search
MQYPEPIAKLIDSYMKLPGIGGKTATRLAFYTIDMNGDDVTEFAKSLIAAKRDLHFCSIC
GNITEDDPCVICKDKSRDQSTVLVVEEAKDVMAMEKIKEYNGLYHVLHGVLSPIDGKGPE
DINIASLLKRLQQNEAIKEVIIATNATPEGEATAMYISRLVKPAGIKVTRLAHGLSVGSD
IQYADEMTLFKAVEGRQEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccagaaccaattgctaagttgattgatagttatatgaagttgcccggcatt
ggtggcaagactgcgacgcggctggcgttttatacaattgatatgaacggtgatgacgtc
accgagttcgctaagtcgctgattgcggccaaacgggacctgcatttttgtagtatttgc
ggtaatatcaccgaagatgatccgtgtgtgatttgtaaggataagtcgcgtgatcaaagc
accgttctggttgttgaagaggccaaggatgtcatggcaatggaaaagattaaggaatac
aacgggctgtatcacgtcttacatggggtattgtcacccattgatggcaaaggtccggaa
gatatcaacattgccagtttattgaaacggctacagcaaaatgaagccatcaaggaagtc
attattgccaccaatgccacgcctgaaggtgaagcaacagcgatgtacatctcgcggtta
gttaagccggcggggatcaaagtgacccgattggcgcatggcttgtcggttggtagtgat
attcaatatgcggatgaaatgaccttattcaaagcagttgaaggtcgccaagaaatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system