KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0532Help
Entry
LPST_C0532        CDS       T01324                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lps03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571181..571780
Genome map
AA seq 199 aa AA seqDB search
MQYPEPIAKLIDSYMKLPGIGGKTATRLAFYTIDMNGDDVTEFAKSLIAAKRDLHFCSIC
GNITEDDPCVICKDKSRDQSTVLVVEEAKDVMAMEKIKEYNGLYHVLHGVLSPIDGKGPE
DINIASLLKRLQQNEAIKEVIIATNATPEGEATAMYISRLVKPAGIKVTRLAHGLSVGSD
IQYADEMTLFKAVEGRQEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccagaaccaattgctaagttgattgatagttatatgaagttgcccggcatt
ggtggcaagactgcgacgcggctggcgttttatacaattgatatgaacggtgatgacgtc
accgagttcgctaagtcgctgattgcggccaaacgggacctgcatttttgtagtatttgc
ggtaatatcaccgaagatgatccgtgtgtgatttgtaaggataagtcgcgtgatcaaagc
accgttctggttgttgaagaggccaaggatgtcatggcaatggaaaagattaaggaatac
aacgggctgtatcacgtcttacatggggtattgtcacccattgatggcaaaggtccggaa
gatatcaacattgccagtttattgaaacggctacagcaaaatgaagccatcaaggaagtc
attattgccaccaatgccacgcctgaaggtgaagcaacagcgatgtacatctcgcggtta
gttaagccggcggggatcaaagtgacccgattggcgcatggcttgtcggttggtagtgat
attcaatatgcggatgaaatgaccttattcaaagcagttgaaggtcgccaagaaatgtaa

DBGET integrated database retrieval system