KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0581Help
Entry
LPST_C0581        CDS       T01324                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LPST_C0581 (galU)
   00052 Galactose metabolism
    LPST_C0581 (galU)
   00500 Starch and sucrose metabolism
    LPST_C0581 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LPST_C0581 (galU)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LPST_C0581 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617909..618829
Genome map
AA seq 306 aa AA seqDB search
MSKVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEARKSGIEDIVIVTGKS
KRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDINLYFIRQSHPRGLGDAVLTAKAFV
GDEPFVVMLGDDLMEDKVPLTKQLMNSYDKTHASTLAVMKVPHEEVSKYGVINPESEKEP
GLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKPGKGDEIQLTDAIDTLNKT
QRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRTYIKDLGAKLSKEDSAAPKT
TKKPTK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttagaaaagccgttatcccagcggccggattaggaacacggtttttgcct
gctactaaggcgatgcctaaagaaatgttaccaatcgttgataaaccaacgattcagttc
attgttgacgaagctcgtaaatcggggatcgaagacattgttatcgtcacgggtaagagc
aagcgtagtattgaagattactatgattctaacccagaattagaggataacttacgggct
aagcacaaggaagaaatgctcaagctggttcaagaaaccacagacattaacttgtacttt
atccggcaatcacacccacgtggtttgggcgatgccgttttaacggctaaagctttcgtt
ggtgacgaacctttcgtcgtcatgcttggtgatgatttaatggaagacaaagtaccgtta
accaaacagttaatgaatagctatgacaagacacatgcgtcaacgttagctgttatgaag
gttcctcatgaggaagtttctaagtatggggttatcaatcctgaaagtgaaaaggaaccg
ggcctatacaacgttaataactttgttgaaaagccatcacctgaagacgcgcctagtgat
cttgctatcattggtcgttacttattaacaccagaaatttttgatgttcttgaaaaccaa
aaacctggtaagggtgacgaaattcaattgacggatgccattgatacgttgaacaagact
cagcgggtctttgcccatgaattcaaggggactcggcacgatgttggctacaagtttggc
tacttgaagacgacgatcgaatacgggttaactcatccggatgttaaggctgacttgcgg
acttacatcaaggatcttggtgctaagttatctaaagaagatagcgccgctcctaaaaca
acgaagaaaccaactaaataa

DBGET integrated database retrieval system