KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0616Help
Entry
LPST_C0616        CDS       T01324                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPST_C0616 (tpiA)
   01230 Biosynthesis of amino acids
    LPST_C0616 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C0616 (tpiA)
   00051 Fructose and mannose metabolism
    LPST_C0616 (tpiA)
   00562 Inositol phosphate metabolism
    LPST_C0616 (tpiA)
Enzymes [BR:lps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LPST_C0616 (tpiA)
Exosome [BR:lps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LPST_C0616 (tpiA)
  Exosomal proteins of bladder cancer cells
   LPST_C0616 (tpiA)
  Exosomal proteins of melanoma cells
   LPST_C0616 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
661823..662581
Genome map
AA seq 252 aa AA seqDB search
MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPALFLQEMVEAAKGSDLK
IAAENAYFEDAGAFTGETSPAALADLGVDYVVIGHSERRGYFHETDEDINKKAHAIFKNG
MKPIICCGESLEQREAGEAESWVSGQIKAALKDLSADQVSSLVIAYEPIWAIGTGKTATS
DQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNELMGKDDIDGGLVGGASLQP
DSFLELVNYQNN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacacctattattgccggtaactggaaaatgaacaaaacagctagcgaagcttta
gctttcgttaatgctgttaaggatcaattaccagatccatcaaaagttgaatcagtcgtt
gctgccccagcccttttcttacaggaaatggttgaagctgccaagggttctgatttaaag
attgctgctgaaaatgcttattttgaagatgctggggcatttactggtgaaacttcacca
gctgccttagctgacttaggcgttgattacgttgttattggtcattcagaacgtcgcggt
tatttccacgaaactgacgaagacattaacaaaaaggcacacgctatcttcaagaacggc
atgaagccaatcatttgctgtggcgaatcattagaacaacgtgaagccggcgaagcagaa
tcatgggtttcaggccaaatcaaggctgctttgaaggacttatcagctgaccaagtaagt
tcattggttattgcctacgaaccaatctgggccatcggtactggtaagactgctacgagt
gaccaagctgaagaaatttgtgcggttgttcgtaagactgttgctgacctttactcacaa
gaagttgctgataaagttcggattcaatacggtggtagtgttaaaccagccaacgttaac
gaattaatgggcaaagatgatatcgacggtggtttagtcggtggtgcttcattacaacct
gattcattcttggaacttgttaattaccaaaataactaa

DBGET integrated database retrieval system