KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0621Help
Entry
LPST_C0621        CDS       T01324                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666969..667718
Genome map
AA seq 249 aa AA seqDB search
MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTVYGPQFSGHATDDPRD
ILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAALERDPQLLGGGTFSSPL
FAGNRSDVAEMFITLSHHQLAHSQFSIAEREQILMTLPELVQRQLQAVNTFTTTEVTSHL
SAVTQPFFIGQGGQDELIDATVARQLRDQLPQVPVDFHWYADAGHVITVNSAHHQLEQDV
LTYLKTIYK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaaacaaccggaaccgtttttctttgaacatggccaacatgccgtcatttta
ttgcacgcctatgcgggaagtgccaatgatgtgcggatgttagcacgagcattagaacgg
gaagattatacagtttatggcccccaattcagtggacacgcgactgatgatccacgagat
attctcgcacagacgccggcgcaatggtggcaagatacgcaacaagcaatatcatttatg
cggcaaaaaggctatactaaaattagtatctttggcttatcattaggtggtatttttgcg
acggcggccttggagcgtgatcctcagttgctaggtggtggcacgtttagttcaccacta
tttgctggtaatcgtagtgacgttgctgaaatgtttatcacgctgagtcaccatcaactg
gcgcacagtcaattttcaattgccgagcgtgaacagatcttaatgacgttgccggaactg
gttcagcggcaattgcaggcagtcaatacctttactacgacagaggttacgagtcacctc
agcgctgtgacccaacctttcttcattggtcagggtgggcaagatgaattaattgatgcg
acggtggcgcgacaattacgtgatcaattaccacaagtaccagttgattttcattggtat
gctgatgctggacacgtgattaccgtcaacagtgcgcatcaccaattggaacaagatgtt
ttaacatatttaaaaactatttataaatga

DBGET integrated database retrieval system