KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0647Help
Entry
LPST_C0647        CDS       T01324                                 

Gene name
galM1
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C0647 (galM1)
   00052 Galactose metabolism
    LPST_C0647 (galM1)
Enzymes [BR:lps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LPST_C0647 (galM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(701987..703036)
Genome map
AA seq 349 aa AA seqDB search
MSGSYGSEGIMKIIEHQGNGINYYTLVNNHHMSVTIMDWGATVTAIKTHDKDGNFANIVL
GFDDGADYITYQSFFGATIARVAGIIKNARWRQYDLTQNAGENHLNGGNMPQISFEPWFL
ERKLHTSDQVGLVMQYITLDGENGYPGTMTITANFVLDNDGKFTISYTGKSDKTTLFNPS
NHTYFNLSGDAERLIDHHVLKINADEYAALNKHGIPTGKLPWVTDTPFDFRDPVEVGPQV
ANIKGGLHHGFVLNDTPYPQVELLDRISGRKVTMRTNAPAVVVSSATNYRDDRYRLNGGK
PMRSQLGLSLQAQKLPDAIHHKEFGSIIIEPNIPVTYQTAYRFSNIYDV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcagctatgggagtgagggcattatgaaaataatcgagcatcaggggaacggg
attaattattatacattagtgaacaatcatcatatgagcgtcactattatggactggggc
gccacagtcaccgcgatcaaaacccatgataaagatggtaattttgcaaatattgtcttg
ggatttgacgacggcgccgactacatcacctatcaatcttttttcggtgcaaccatcgct
cgggttgcggggatcatcaaaaatgcccggtggcggcagtatgacttaactcaaaatgcg
ggcgaaaatcatctaaacggtggtaatatgcctcaaatttcatttgaaccatggttttta
gaacgtaaactgcacactagtgatcaagttggactcgtcatgcaatatattaccttggac
ggtgagaacggctatcccgggacaatgacgatcacggctaatttcgtattagataacgac
ggtaaatttactattagctacactggtaaaagtgataaaacaaccttattcaaccccagc
aaccatacctacttcaatctaagtggggatgcggaacgcctcattgaccaccatgttctt
aaaatcaatgcagacgagtacgccgcgttaaacaaacacggtattccaactggtaagttg
ccatgggtcaccgacaccccatttgattttcgtgacccagtcgaggttgggccccaggtt
gctaacatcaagggcgggctccatcacggcttcgtcttaaacgacaccccatatccacaa
gtagaattactagatcgcatcagtggacgcaaagtcacgatgcgaacgaacgctccggca
gtcgtggtttccagtgcaactaattaccgtgatgatcgttatcgactcaatggcggtaaa
ccgatgcgttctcaacttggtctttccctgcaagcacaaaaattaccggatgctattcac
cacaaggaatttggcagtatcattatcgaacctaatattcctgtaacctaccaaacggcc
tatcgtttttctaatatttacgacgtctaa

DBGET integrated database retrieval system