KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0782Help
Entry
LPST_C0782        CDS       T01324                                 

Definition
(RefSeq) alpha-ribazole-5'-phosphate phosphatase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPST_C0782
   01230 Biosynthesis of amino acids
    LPST_C0782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C0782
  Energy metabolism
   00680 Methane metabolism
    LPST_C0782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPST_C0782
Enzymes [BR:lps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LPST_C0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
857099..857767
Genome map
AA seq 222 aa AA seqDB search
MQIYFIRHGRTQYNLEHRFQGGRADSPLVASGIDGAKAAGDYLSTTQFSAVYSSPQQRAL
DTAKYIVAANQWQPPIQIDDGLREFDFGDWDGKQEAEVQPQSYAQVIFTKPAEYRPELAG
GGESYADFVTRTTSTLHRLIDQVGVASTQPLLIVSHGLVTTMTVKALMGVPVAELRAPFV
VDGQVMKTVGHGIVDNDSLTVLSTTDNQHFELTTWNETGYLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttatttcattcgtcacggtcgaacacaatataacttagaacaccgatttcaa
ggtggacgagcagattccccgctggttgctagcggaatcgatggggcaaaggccgctggt
gattacttaagcaccacccaattttcagcagtatatagcagtccgcagcaacgagcgctg
gatacggcgaaatacattgtggctgccaatcagtggcaaccgccgattcaaatcgacgat
ggcttgcgtgagtttgattttggtgattgggacggcaaacaggaagcggaagtacagccg
cagtcctacgcccaagttatttttactaaacccgccgaataccgaccggaactagctggc
ggtggcgaaagttatgcggattttgtcacccgaacgacttcgacgctacatcgtttgatt
gatcaagttggggtagctagcacgcaaccactattaatcgtatcgcacggtctggtgacg
acgatgactgtcaaggcgttaatgggtgtccccgtagcagaattacgagcaccttttgtg
gtcgatgggcaagttatgaagacagtgggccacggtatcgtggataatgatagcctgaca
gtgttatcgacgacggataatcagcattttgaactgacgacttggaatgaaaccgggtac
ttgaagtaa

DBGET integrated database retrieval system