KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0782Help
Entry
LPST_C0782        CDS       T01324                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase (putative)
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
857099..857767
Genome map
AA seq 222 aa AA seqDB search
MQIYFIRHGRTQYNLEHRFQGGRADSPLVASGIDGAKAAGDYLSTTQFSAVYSSPQQRAL
DTAKYIVAANQWQPPIQIDDGLREFDFGDWDGKQEAEVQPQSYAQVIFTKPAEYRPELAG
GGESYADFVTRTTSTLHRLIDQVGVASTQPLLIVSHGLVTTMTVKALMGVPVAELRAPFV
VDGQVMKTVGHGIVDNDSLTVLSTTDNQHFELTTWNETGYLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttatttcattcgtcacggtcgaacacaatataacttagaacaccgatttcaa
ggtggacgagcagattccccgctggttgctagcggaatcgatggggcaaaggccgctggt
gattacttaagcaccacccaattttcagcagtatatagcagtccgcagcaacgagcgctg
gatacggcgaaatacattgtggctgccaatcagtggcaaccgccgattcaaatcgacgat
ggcttgcgtgagtttgattttggtgattgggacggcaaacaggaagcggaagtacagccg
cagtcctacgcccaagttatttttactaaacccgccgaataccgaccggaactagctggc
ggtggcgaaagttatgcggattttgtcacccgaacgacttcgacgctacatcgtttgatt
gatcaagttggggtagctagcacgcaaccactattaatcgtatcgcacggtctggtgacg
acgatgactgtcaaggcgttaatgggtgtccccgtagcagaattacgagcaccttttgtg
gtcgatgggcaagttatgaagacagtgggccacggtatcgtggataatgatagcctgaca
gtgttatcgacgacggataatcagcattttgaactgacgacttggaatgaaaccgggtac
ttgaagtaa

DBGET integrated database retrieval system