KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C0782Help
Entry
LPST_C0782        CDS       T01324                                 

Definition
alpha-ribazole-5'-phosphate phosphatase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPST_C0782
   01230 Biosynthesis of amino acids
    LPST_C0782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C0782
  Energy metabolism
   00680 Methane metabolism
    LPST_C0782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPST_C0782
Enzymes [BR:lps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LPST_C0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857099..857767
Genome map
AA seq 222 aa AA seqDB search
MQIYFIRHGRTQYNLEHRFQGGRADSPLVASGIDGAKAAGDYLSTTQFSAVYSSPQQRAL
DTAKYIVAANQWQPPIQIDDGLREFDFGDWDGKQEAEVQPQSYAQVIFTKPAEYRPELAG
GGESYADFVTRTTSTLHRLIDQVGVASTQPLLIVSHGLVTTMTVKALMGVPVAELRAPFV
VDGQVMKTVGHGIVDNDSLTVLSTTDNQHFELTTWNETGYLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttatttcattcgtcacggtcgaacacaatataacttagaacaccgatttcaa
ggtggacgagcagattccccgctggttgctagcggaatcgatggggcaaaggccgctggt
gattacttaagcaccacccaattttcagcagtatatagcagtccgcagcaacgagcgctg
gatacggcgaaatacattgtggctgccaatcagtggcaaccgccgattcaaatcgacgat
ggcttgcgtgagtttgattttggtgattgggacggcaaacaggaagcggaagtacagccg
cagtcctacgcccaagttatttttactaaacccgccgaataccgaccggaactagctggc
ggtggcgaaagttatgcggattttgtcacccgaacgacttcgacgctacatcgtttgatt
gatcaagttggggtagctagcacgcaaccactattaatcgtatcgcacggtctggtgacg
acgatgactgtcaaggcgttaatgggtgtccccgtagcagaattacgagcaccttttgtg
gtcgatgggcaagttatgaagacagtgggccacggtatcgtggataatgatagcctgaca
gtgttatcgacgacggataatcagcattttgaactgacgacttggaatgaaaccgggtac
ttgaagtaa

DBGET integrated database retrieval system