KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1314Help
Entry
LPST_C1314        CDS       T01324                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01130  Biosynthesis of antibiotics
lps01230  Biosynthesis of amino acids
Module
lps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPST_C1314 (trpC)
Enzymes [BR:lps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LPST_C1314 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C FMN_dh PDZ
Motif
Other DBs
NCBI-ProteinID: ADN98533
Position
1443277..1444059
Genome map
AA seq 260 aa AA seqDB search
MILDQLVQASQQRVQKVPVRERVKRIQQARKMTTPVLSFEAMLAQPGLQLIGEVKRASPS
KGLIAAEFDYLQIAQDYVAAGIDAISVLTEPRYFKGQLSYLQAIAQTVSVPTLRKDFIVA
ASQIASARIAGASAVLLIVAILTPVQLQAFITLAHELNLSALVEVHTTAEIKQAVAAGAR
IIGINNRNLKDFSVNFATSRQLRQAVPAECYVIAESGIQTSTQVQTLAAADFDAILVGET
LMRAPDKQQAVRQLRAGVRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatcaactcgtccaggcgagtcagcaacgggttcagaaggtaccagttagg
gagcgtgtgaagcgcattcaacaagctcgaaaaatgaccacccccgttttatcatttgaa
gcaatgctggcccagccgggcttacagcttattggtgaagttaagcgggcgtcaccttct
aaggggctgattgcggctgagtttgactatttacagattgcgcaagactatgttgctgct
gggatcgatgccatctcagtgttgaccgaaccccggtattttaaaggacagttgtcttac
ttacaagccattgcgcaaacggtctcggtacccacattacgtaaagattttattgtagct
gctagtcagattgcgagtgctcgtattgctggtgctagtgcggttttattgattgttgct
attttaacaccggttcaactgcaggctttcattacgttggctcatgagctgaatttaagt
gcgctagttgaagtccatacaacggctgagattaagcaagcggtggcggctggggcccgg
attattggcattaataatcggaatttgaaagatttcagtgtcaattttgcaacgagtcgc
cagttgcggcaagcggttccggctgagtgttatgtgattgccgagtctggcattcaaacg
tcgacgcaagtacaaacgttggcggccgccgactttgacgctattttagtcggcgaaacg
ttgatgcgtgcgccagataagcagcaagctgtcagacaactgcgggcgggggtgcgtgga
tga

DBGET integrated database retrieval system