KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1317Help
Entry
LPST_C1317        CDS       T01324                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00260  Glycine, serine and threonine metabolism
lps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01130  Biosynthesis of antibiotics
lps01230  Biosynthesis of amino acids
Module
lps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPST_C1317 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPST_C1317 (trpA)
Enzymes [BR:lps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LPST_C1317 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA DUF561 GcpE UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-ProteinID: ADN98536
Position
1445873..1446670
Genome map
AA seq 265 aa AA seqDB search
MMTDLTTIFKNHKAFIAFVVAGDPNFEATVDQVVALAEAGCDLVEIGIPFSDPVADGPEI
QAADLRAFDQHITPQRVFELVVAIREKTTIPLVFLIYANIVYQFGYAAFAQQCQSLNVAG
LIIPDMPLEASGELRPTFDHYGIALIPLIAPTSDDARIAAIAQQARGFIYVVSSLGVTGT
RRHITTDLATLVAKIRHATTLPVAIGFGIHEPAQAQAMAQIADGVIVGSAVVHLIATHQP
ATAVLRDYTRRMRRALDGRTADTVD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgatgactgatttaacaacaatttttaaaaatcataaggcgtttattgcttttgtagtg
gccggtgatcctaattttgaagcgacagttgaccaagttgttgcgttagcagaagcgggt
tgtgatctcgttgagattggcattccgttctcagaccctgtggctgatggtcccgaaatt
caggccgctgatctccgtgcgtttgaccaacacatcacaccccaacgcgtttttgaattg
gtggtggcaattcgagagaagacaactattccactcgtgtttttaatctatgcgaacatt
gtttatcagtttggttatgctgcctttgcccagcagtgtcaaagtttgaatgtcgcaggc
ttgattattcccgacatgccactagaagcctctggtgaacttcgaccaaccttcgaccac
tatggtattgctttgattccattgattgcgccaacgagtgatgatgcacgcatcgcagcg
attgcccagcaggcgcggggcttcatttatgtcgtatcatcactaggtgtcacggggacc
cggcgacacatcacgactgatttagcaacactggtggcgaagattcgccatgcgactacg
ttacctgtcgcaattggttttggtatccatgagccagctcaggcccaggccatggcacaa
attgcggacggggtcatcgttggtagtgcagtcgtgcatttgattgcgacgcaccaacca
gcgacagcagtcttaagggactatacgcgacggatgcggcgcgcattggatggtcgcacg
gctgatacagttgactga

DBGET integrated database retrieval system