KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1524Help
Entry
LPST_C1524        CDS       T01324                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00010  Glycolysis / Gluconeogenesis
lps00030  Pentose phosphate pathway
lps00051  Fructose and mannose metabolism
lps00052  Galactose metabolism
lps00680  Methane metabolism
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01120  Microbial metabolism in diverse environments
lps01130  Biosynthesis of antibiotics
lps01200  Carbon metabolism
lps01230  Biosynthesis of amino acids
lps03018  RNA degradation
Module
lps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C1524 (pfkA)
   00030 Pentose phosphate pathway
    LPST_C1524 (pfkA)
   00051 Fructose and mannose metabolism
    LPST_C1524 (pfkA)
   00052 Galactose metabolism
    LPST_C1524 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LPST_C1524 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LPST_C1524 (pfkA)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LPST_C1524 (pfkA)
Protein phosphatases and associated proteins [BR:lps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LPST_C1524 (pfkA)
Messenger RNA biogenesis [BR:lps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LPST_C1524 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADN98740
Position
complement(1650556..1651518)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVAGKAMAEGLEAYGINYGFAGLVAGDIHKIEAADLDGV
IQRGGTLLYSARYPEFAHEEGQLKGIEQLKRFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPYTDFTIGFDTAVNTNVQALDRIYDTAHSHDRTFVVEVMGRGAGDVALWS
GVSIGATAIVVPEVDWDMEEIANKIKHNRANGHRSNLIVLAEGVMGAQEFVEKLSEYGDF
DARGNTIAHMQRGGNPTAKDRVMASKMGAYAVELLLAGKGGLAVGIQNNQLVNHNILDLF
ESKHDVEVSLDKLNEEISFK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagtggcggcgacgctcctggtatgaatgcggccgtt
cgtgcagttgctggtaaagcaatggctgaagggttggaagcatacggcatcaattacggc
tttgctggattagttgccggtgacattcacaaaatagaagcagccgacttagatggtgtg
attcaacgcggcggaactttactatactccgcacgttatccagaatttgcccatgaagaa
ggtcaattaaaagggatcgaacaattgaagcggtttgggattgatgctttagttgttatc
ggtggcgacggttcttaccatggcgcattgcgcttaacggaacacggctacaacacgatt
ggtcttccagggacgatcgataatgatattccttacacggacttcacaattggttttgac
actgctgtcaacaccaacgtgcaagctcttgaccggatttatgatacggctcatagtcat
gaccggactttcgttgtggaagttatgggtcgtggcgctggtgacgtagccttatggtcc
ggtgtttcaatcggcgcgactgctatcgtggtccccgaagttgattgggacatggaagaa
atcgccaacaagattaagcataaccgggccaatggtcatcggagcaacttgattgtgtta
gccgaaggtgtgatgggtgcccaggagtttgttgagaagttatccgaatatggtgacttt
gatgctcgtgggaataccattgctcatatgcaacgtggtgggaatccaactgctaaagac
cgtgtcatggccagcaagatgggtgcctacgctgtggaactcttgcttgccggcaagggt
ggcttagcggttgggattcaaaacaaccaattagtcaaccacaacatcttagatttattt
gaatctaagcatgacgttgaagtgtcattagataagttgaatgaagaaatttcattcaag
taa

DBGET integrated database retrieval system