KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1524Help
Entry
LPST_C1524        CDS       T01324                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPST_C1524 (pfkA)
   01230 Biosynthesis of amino acids
    LPST_C1524 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C1524 (pfkA)
   00030 Pentose phosphate pathway
    LPST_C1524 (pfkA)
   00051 Fructose and mannose metabolism
    LPST_C1524 (pfkA)
   00052 Galactose metabolism
    LPST_C1524 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LPST_C1524 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LPST_C1524 (pfkA)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LPST_C1524 (pfkA)
Protein phosphatases and associated proteins [BR:lps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LPST_C1524 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650556..1651518)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVAGKAMAEGLEAYGINYGFAGLVAGDIHKIEAADLDGV
IQRGGTLLYSARYPEFAHEEGQLKGIEQLKRFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPYTDFTIGFDTAVNTNVQALDRIYDTAHSHDRTFVVEVMGRGAGDVALWS
GVSIGATAIVVPEVDWDMEEIANKIKHNRANGHRSNLIVLAEGVMGAQEFVEKLSEYGDF
DARGNTIAHMQRGGNPTAKDRVMASKMGAYAVELLLAGKGGLAVGIQNNQLVNHNILDLF
ESKHDVEVSLDKLNEEISFK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagtggcggcgacgctcctggtatgaatgcggccgtt
cgtgcagttgctggtaaagcaatggctgaagggttggaagcatacggcatcaattacggc
tttgctggattagttgccggtgacattcacaaaatagaagcagccgacttagatggtgtg
attcaacgcggcggaactttactatactccgcacgttatccagaatttgcccatgaagaa
ggtcaattaaaagggatcgaacaattgaagcggtttgggattgatgctttagttgttatc
ggtggcgacggttcttaccatggcgcattgcgcttaacggaacacggctacaacacgatt
ggtcttccagggacgatcgataatgatattccttacacggacttcacaattggttttgac
actgctgtcaacaccaacgtgcaagctcttgaccggatttatgatacggctcatagtcat
gaccggactttcgttgtggaagttatgggtcgtggcgctggtgacgtagccttatggtcc
ggtgtttcaatcggcgcgactgctatcgtggtccccgaagttgattgggacatggaagaa
atcgccaacaagattaagcataaccgggccaatggtcatcggagcaacttgattgtgtta
gccgaaggtgtgatgggtgcccaggagtttgttgagaagttatccgaatatggtgacttt
gatgctcgtgggaataccattgctcatatgcaacgtggtgggaatccaactgctaaagac
cgtgtcatggccagcaagatgggtgcctacgctgtggaactcttgcttgccggcaagggt
ggcttagcggttgggattcaaaacaaccaattagtcaaccacaacatcttagatttattt
gaatctaagcatgacgttgaagtgtcattagataagttgaatgaagaaatttcattcaag
taa

DBGET integrated database retrieval system