KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1776Help
Entry
LPST_C1776        CDS       T01324                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00010  Glycolysis / Gluconeogenesis
lps00020  Citrate cycle (TCA cycle)
lps00620  Pyruvate metabolism
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01120  Microbial metabolism in diverse environments
lps01130  Biosynthesis of antibiotics
lps01200  Carbon metabolism
Module
lps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C1776 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LPST_C1776 (pdhC)
   00620 Pyruvate metabolism
    LPST_C1776 (pdhC)
Enzymes [BR:lps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LPST_C1776 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ADN98992
Position
complement(1910027..1911343)
Genome map
AA seq 438 aa AA seqDB search
MAYEFKLPELGEGLEEGEIASWLVKPGDEVKEDDSLVEIQNDKSVEELPSPVSGKVIDIL
VPEGETAKIGDVIVTIDDGSGDAAPAAKAETPAATKTEAPASEAAETPAATSAQPTGTPA
AGNPNKRVLAMPSVRQYARDKDIDITLVTPTGAHGQITKQDIDNYTGAPAATGAKPAATP
ATTAPAASEAPAPTPVKPYVSDTPELETREKMTPIRKAISKAMVNSKHTAPHVTLFDEVE
VSALMAHRKKYKQVALDRDIHLTFLPYFVKALVAVLQQFPELNASIDDANKEIVYKHYFN
IGVATDTDRGLLVPNIKHAEGKGLFAIAKEITDNTQKAYDGKLKASEMSGGSITISNIGS
IGGGWFTPVINQPEVAILGVGRIGKEPYVNDDGEIVVGKMQKLSLSFDHRLIDGATAQRA
MNLLKQLLHDPELLLMEG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagtttaaattaccagagcttggtgaaggtcttgaagaaggcgaaattgca
tcatggctcgtaaaacctggtgatgaagtcaaagaagacgattctctagttgaaattcaa
aatgataaatcggtggaagaattaccatcgccagtaagtggtaaagttattgatatttta
gttccagaaggtgaaacggctaaaattggtgatgtgatcgtcacgattgacgatggttct
ggcgacgctgcgccagcggctaaggctgaaacaccagcggctactaagacggaagccccg
gcaagtgaagcagctgaaactcccgctgcaacatcagcacaaccgactggaaccccggct
gcgggcaatcctaataaacgggtcttggcaatgccatcagtgcgccagtacgcacgtgat
aaggacattgacatcacgttagttacgccaactggtgcccatggtcagatcacaaagcaa
gatattgacaattacacaggtgcgccagcggcaacgggtgctaaaccagcagctacgcca
gcgacaacggctccggctgcaagtgaagcaccagcaccaacaccagttaaaccatatgtt
tctgacacacctgaattagagacgcgtgaaaagatgacgccaattcggaaggcaatctct
aaggctatggtgaatagtaaacacaccgcgccacatgttactttatttgatgaagttgaa
gtgagtgcgttgatggcacaccggaagaagtacaagcaagttgctttggatcgcgacatc
catcttaccttcttaccatacttcgtgaaagctttggttgcggttttacaacaattccca
gaattgaacgcgtcgatcgatgatgcaaacaaggaaattgtttacaaacactacttcaat
attggggtagctaccgatactgaccgtggattgttagtgccaaatattaagcacgctgaa
ggtaagggcttgtttgcaattgccaaagaaattactgacaatacgcaaaaagcttacgat
ggcaagttaaaggccagtgaaatgagcggtgggtctattactattagtaatattggctca
attggcggcggctggtttaccccagttatcaaccaaccggaagttgccattttaggtgtt
gggcgtatcggtaaggaaccttacgtcaatgacgatggtgaaatcgttgttggtaagatg
cagaagttgtccttgagttttgatcaccgtctgattgatggtgcaacggcccaacgggca
atgaacttattgaagcaattgttacatgatccagaattacttttgatggaaggatga

DBGET integrated database retrieval system