KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1787Help
Entry
LPST_C1787        CDS       T01324                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LPST_C1787 (recD)
Enzymes [BR:lps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LPST_C1787 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921638..1924187)
Genome map
AA seq 849 aa AA seqDB search
MTDEQAHLFSDDIGREPVTHFIVGKVAAVFFSSADSFYKVLLVKVTEQNIDWSEDEIVVT
GNFADIQEETTYRFTGKTVTHPKYGVQFQADNYQNETPTTRAGLIAYLSGSDFPGLGKRT
AERIVDTLGEDAIDQILADPKVLKPIGLRASVQTTLIDTLTVNNGLEQTIIGLNAYGFGS
RLAAAIYARYQGDTLAKIQENPYCLVEDIKGVGFKKADQIAAQLKIDPQADDRLKAALLT
EINELCVENGDTYTTAQPLLNQTLQLLENARNVQIDPSKLADQLVVLAKENKIVGDENRI
YLRGLYEAEWRVAEHLQRLLAADNDEKLSERAVDHAIEHVGRASNITYDESQTEALKAAI
TAPVFLLTGGPGTGKTTIIRGLVALYAELHDVALDINQYKDKPFPILLAAPTGRAAKRMA
ETTGLPASTIHRLLGLTGREDGPEEPSKELDGGLLIIDEMSMVDTVLFQQLLTAIPSHMQ
VILVGDKDQLPSVGAGQVFHDLLKFSELPQIELTTIYRQGNDSSIIPLAHAIKDGYLPAD
FAVNQPDRSFIACNAYQVNHIVEQVVARAKAKGFSAEEVQILAPMYRGTAGIDQLNTTVQ
KIFNPLKSARQKHLTYNGQDFRVGDKVLHLVNSPEDNVFNGDIGKIVGIDLANDSHNESK
KDQITIAFDQNEVTYQRNEWNRLTLAYSMSIHKSQGSQFKMVILPLVPQFARMLQRNLLY
TAVTRAEQMLILLGDSQSFERSVTNESVNRQTTLTKRLQQVFCGDTVSDETATIATTDQA
EAMPAGEKATAVKKVASDEESATEKTQEPSSQSAGPTILTPALVSAGRIDPMIGMNGITP
ANFMPQVAN
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgaacaagcacatttattttccgacgatattggtcgggaaccggtcacacac
tttatcgtcggtaaagtcgctgccgttttttttagcagtgccgatagtttttataaagtc
ttattagtcaaagtaactgaacagaacattgattggtcggaagatgagatcgttgttact
ggaaattttgcggatattcaggaggagacaacgtatcgttttaccggtaaaacggtcacg
catcccaaatacggggttcagtttcaagcggataattatcaaaatgaaacgcccacgaca
cgcgcaggcttgattgcctatctatctggtagtgattttcctgggttgggtaagcggact
gctgagcgaatcgtcgatactttgggcgaagatgccattgatcaaattttagctgatccg
aaggttttaaaaccaatcggacttcgggccagcgttcagacgactttgatcgacacgctc
acggtcaataacggtttggagcaaactatcattggacttaatgcgtacggttttgggagt
cggttagctgcggccatctatgcacgctatcaaggtgacactttggctaagattcaagag
aacccgtactgtttggttgaggatatcaaaggcgtcgggttcaaaaaagcggatcaaatt
gcggcccaacttaaaattgatccccaagcggatgaccggttaaaggcggccctattgact
gagattaatgagctgtgcgtggaaaacggtgatacgtataccacggctcaaccgttgctg
aatcaaacgttgcaactacttgagaatgctcgcaatgttcaaattgatccttcgaagctg
gctgatcagttggtcgtcttggcgaaggaaaataaaatcgtgggtgacgagaatcgtatc
tacttgcgcggcctctatgaagccgagtggcgcgttgcggaacatttacaacggttgtta
gccgccgataatgatgaaaaattgtctgaacgtgccgtggatcatgctatcgagcatgtc
ggtcgagctagcaacattacttatgatgaatcacaaaccgaagcactaaaagcggcgatt
acggcgcctgtttttctactaactgggggaccggggactggtaaaacgaccattatccgt
ggcttagtcgcgctctatgcggaattacacgacgttgcactagatatcaatcagtataag
gataagccttttccaattctgttggcggcaccgactggacgggcagccaagcggatggct
gaaacgactgggctcccagctagtactattcatcggttgcttgggttgacggggcgtgaa
gatggtcccgaggagcctagtaaggaattagatgggggcctcctgattattgacgaaatg
tcgatggttgacacggtactgtttcagcagttactgacggcgattccaagtcacatgcaa
gtcattcttgttggcgataaggatcaactgccatcggtaggagccgggcaagtgtttcat
gatttattgaagtttagtgaactgccccaaattgagttaacgacaatctaccggcagggc
aatgattccagtattattccgttggcccacgccatcaaagatggttatttaccggccgat
tttgccgtcaaccaaccggatcgctcatttattgcctgcaacgcttatcaagtcaatcac
attgttgaacaagttgtggcacgtgccaaggcgaagggcttcagtgctgaggaggtacaa
attctggccccgatgtatcgcggcactgccgggatcgatcagctgaataccacggttcag
aaaatctttaatccgttgaagagtgcccgtcagaagcatctaacgtataacggtcaagat
tttcgggtcggtgataaggtcctgcacctcgttaattcacccgaggataatgtttttaat
ggcgacattggtaaaatcgtcggtatcgatctggcaaatgattctcacaatgaatcgaag
aaagaccagatcacgattgcctttgatcaaaatgaagtgacttatcaacgcaatgaatgg
aatcgattgacattagcgtacagtatgtcgatccacaagtctcaagggagccagtttaaa
atggtgattctgccactggtaccacaatttgcacggatgctacaacgcaatctactgtat
actgccgtgacacgtgctgaacaaatgctgatcctgttaggtgatagtcaatcatttgag
cggagcgttaccaatgaatcggttaatcgccaaaccacactgacgaaacggttacaacaa
gtcttttgcggggataccgtatccgatgaaacggccactattgcgactactgaccaagca
gaggcaatgccagccggcgaaaaagcgacggcggttaagaaagttgcttctgacgaggag
tcggccactgaaaaaactcaggaaccgagttcccagtctgctggaccaacaattttgacc
ccagcgctagtcagcgctggccgaatcgatccgatgattggcatgaatggtatcacgcca
gctaatttcatgccgcaagtagctaattga

DBGET integrated database retrieval system