KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1980Help
Entry
LPST_C1980        CDS       T01324                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase ()
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lps00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lps00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126166..2127512
Genome map
AA seq 448 aa AA seqDB search
MSINSTLATWTGKSAYWFLHTFRGGGSSLPGKLALKLDPTILKHLAKNYDVIVITGTNGK
TLTTALTVKVLREQYPDILTNPSGSNMKQGIVTTFLRAPKAHQKPLAVLEVDEANVIMVT
KYITPKAFVFTNIFRDQMDRYGEIYTTYQKILDGVALAPEATIIANGDLPLFNAKQLPNP
ILYYGFDYQPDHDQQAPANTDGLLCPRCQHILRYHSRTYSNMGKYYCPHCGFERPQLTYK
LNALTAMTPTSSDFEINGQAMHLNIGGQYNIYNALAAYAVGRFMDVTPAKIAHALSDNDE
QVFGRQETFHVGEKDVTLILVKNPVGLNQVLQTISTDDRPFSFAALLNANYADGIDTSWI
WDGNFEKLPALNIPAYISGGERYRDITFRLKVAGVPEDQLTIIPDLTNMTTAIQKLPTKQ
VYVVATYTAMLQLRKQLASQGIIDGGMA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaatagtacattagccacctggacgggtaaatccgcatattggtttttacac
accttccgtggcggtgggagctcactccccggcaagttagcgctgaagctcgatccaacg
attttaaagcatctcgctaaaaactacgacgtcatcgtcatcactgggaccaacggtaaa
acgttaacgaccgccttgacggtcaaggttttacgtgaacagtaccctgacattttaacc
aatccaagcggatccaacatgaagcaaggtatcgtcacgacctttttacgggcacctaaa
gcgcaccaaaagccactcgcagttctagaagtcgacgaagctaacgtaatcatggtcacc
aagtacatcacaccaaaagcctttgtcttcacgaacattttccgtgaccagatggatcga
tatggtgaaatctacacgacatatcaaaaaatcttagacggggttgctttagcacctgaa
gcgacaattattgccaacggtgatttgccactcttcaatgccaaacaattgcctaatccg
atactgtattacggatttgactaccagcccgaccatgaccaacaagcgccagcaaatacg
gatggcctgctttgtccgcgttgtcagcatattttgcgttaccatagtcgaacttatagc
aatatgggcaagtattattgtccccactgcggttttgagcgtccacagttgacatacaaa
ttaaacgccctaaccgctatgacaccgactagctcagactttgaaatcaacggtcaggcc
atgcatcttaatatcggtggtcaatacaatatttataatgcgctagctgcctacgcggtt
gggcgcttcatggacgtcacgccggccaaaatcgcgcacgcccttagcgacaacgatgaa
caagtctttggtcgtcaagagacctttcacgttggcgaaaaggacgtcacgctgattctc
gtcaagaatccagtgggccttaaccaagtcttgcaaacaatcagcaccgatgaccggcca
ttctcatttgccgctctgctcaacgcaaactatgcagatggtattgatactagttggatc
tgggatggtaattttgaaaaattaccggcattgaatattcccgcctatattagtggcggt
gaacgttatcgtgatatcacgttccggctaaaagttgctggcgtaccggaagatcagtta
accattattcctgacctgaccaacatgacgaccgcaattcaaaaactaccgaccaagcaa
gtctacgtcgtcgcaacttacaccgcgatgttgcaattacgaaaacaacttgctagccaa
ggcattatcgatggggggatggcttaa

DBGET integrated database retrieval system