KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2241Help
Entry
LPST_C2241        CDS       T01324                                 

Gene name
purK1
Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LPST_C2241 (purK1)
Enzymes [BR:lps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     LPST_C2241 (purK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2395477..2396607)
Genome map
AA seq 376 aa AA seqDB search
MNANFKEALLPPATIGIVGGGQLGQMMTLSAKAMGYRVGVLDPTPKAPAAQVADFQIVAA
YDDQAALLDLARRSDVLTYEFENVDENALIAAQAYAKLPQGTALLHITGDRLNEKQFLHD
HGIPVTSFAPVTDLQSLNYALNRVGTPAILKTAAGGYDGHGQTDLDTAVVTKAASALLTQ
PCILEARQKFRTEVSMMVTRSAAGVVTTFPLVENQHQHHILHTTIAPANVQPSVHSAARK
IAVSIAESLELRGVLGIEFFVLPDDTLLVNELAPRPHNSGHYTIEACNISQFEAHIRSIC
GLPIPAITQTSPAVMRNLLGDDLTVARQQLVEHPEWHFHDYGKAAIKPQRKMGHVTVLNH
DIDAALASLANLKGEQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccaattttaaggaagcactcttaccacccgcaacgatcggaatcgttggtggc
ggtcaactcggtcagatgatgacgcttagcgcgaaggcgatgggctatcgggtaggtgtc
cttgacccgacacccaaagcaccggcagcccaggtcgcagattttcagattgttgcggct
tatgatgatcaggcggctttacttgatctagcgcgccgtagtgatgtcttgacctacgag
tttgaaaacgttgatgagaatgctttgattgctgcgcaagcctatgcaaagttaccgcag
ggcactgcactcctgcatattactggagatcgtcttaatgagaagcaatttcttcatgat
catggcatcccagtcacatctttcgcaccggtgacggatttacagtcattaaattacgcc
ctcaaccgtgttggtacgccggcaattctcaaaacggcggcaggtggctacgatggtcac
ggacaaacggatctagacacagcagtggtgacaaaagccgctagtgccttattgacacag
ccgtgcattctagaggcgcggcagaaatttcgaacagaagtttccatgatggtgacgcgt
agtgctgctggtgttgttacgacttttccgttagttgaaaatcagcatcaacatcatatc
ttacacacaacgattgccccagctaatgttcagcccagtgttcatagtgcggcccgcaaa
attgcggtttcgattgctgaatctctggaactacgcggcgtgctaggaatcgaattcttt
gttttaccggatgatactttattagtcaatgaactggcaccacgcccacataattctggt
cactatacgattgaggcctgcaacatctcgcagtttgaggcccatattcgaagtatctgt
ggcttaccgattccggccattacgcagaccagtccggcagtgatgcgtaatctgctaggt
gatgacttaacagtggcacgtcaacagttggttgaacacccagaatggcattttcacgac
tacggtaaggcggccattaagccccagcgcaagatgggtcatgtcaccgtattaaatcac
gatattgacgcagcattagcgtcgttggcaaatttgaaaggggaacaataa

DBGET integrated database retrieval system