KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2266Help
Entry
LPST_C2266        CDS       T01324                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00260  Glycine, serine and threonine metabolism
lps00750  Vitamin B6 metabolism
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01120  Microbial metabolism in diverse environments
lps01230  Biosynthesis of amino acids
Module
lps_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPST_C2266 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LPST_C2266 (thrC)
Enzymes [BR:lps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LPST_C2266 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP EPO_TPO SnoaL_4
Motif
Other DBs
NCBI-ProteinID: ADN99481
Position
2418487..2419980
Genome map
AA seq 497 aa AA seqDB search
MKTLYRSTRETASHTMTSSQAVLQGLTPDGGLFVPVTLPTANFDFDQLATMSYQEVAYEV
LKLFFTDYTADELHACIDAAYGDQFDDPQIAPVTKHGQQYYLELFHGPTIAFKDLALQIL
PHLMTTAVKKNHLQAEVVILAATSGDTGKAAMAGFANVDQTRIIVFYPKDGVSAIQKQQM
VTQTGANTSVVAINGNFDEAQTTVKKLLNDHQLHAELATHQFQFSSANSINIGRLFPQVA
YYVYTYAQLIKQGQIKNGDEINFSVPTGNFGDILAGYYAKQLGTPIHKLICASNRNNVLT
DFFNTGTYDKNREFFLTSSPSMDILVSSNLERLLFYLTGSDATATAKLMTDLQTTGRYTI
TPAMRANLADFWAGFVTESQDQAEIHHLNHAHHYTIDPHTAVASAVAKQYQAATRDQRPM
VVVSTASPYKFPQAVLTAITGELSAVDGLAAVDQLHELIQTPIPATVTALRTAPVRHKRV
ADVDDMGTTIKTILNLN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactttatcgcagtacccgcgaaactgcaagtcacaccatgacgtcatcacaa
gccgtacttcaaggcctgacgccggatggtggtctctttgtgcccgtaacgctaccgacc
gctaattttgacttcgaccagctcgccacgatgagctaccaagaagttgcttacgaggtc
cttaaactcttcttcacggattataccgctgatgaattacacgcctgcattgacgcggct
tatggtgatcagtttgatgacccccaaattgcgccggtcaccaagcatggtcagcagtat
taccttgaactttttcatggaccgaccattgcattcaaagacttggcccttcaaatccta
ccgcatttgatgacaacggcagttaaaaagaaccatttacaagccgaagtcgttatttta
gcggccacctcgggcgatactggtaaagctgccatggccgggtttgccaatgttgatcag
actcgcatcatcgtcttctatccaaaagatggtgtcagcgcaatccaaaaacagcagatg
gtgacccaaaccggagccaatactagtgttgttgcgatcaacggtaacttcgatgaggcc
caaacaacggttaaaaaactgttaaacgaccaccaattacacgcggaattagccacccac
cagttccaattctcaagcgctaattccatcaatattggtcgtttattcccacaagtggcc
tattatgtctacacctacgctcaacttatcaagcaggggcaaatcaagaacggtgatgag
attaactttagtgttccaactgggaactttggggatattttagctggctactatgccaaa
caactgggcacgcccattcataaactgatctgtgcttccaatcgcaataacgttctcacc
gatttctttaataccgggacttatgataaaaaccgtgaattcttcttgacgagttcaccg
tccatggacatcttagtctcaagtaacttggaacggctcctcttctacttgacaggatca
gacgccacggcgactgctaaactaatgactgatttgcaaacgaccggccgttatacgatt
acaccggcaatgcgtgccaacttagctgatttttgggccggcttcgtgactgaaagccaa
gatcaagctgaaattcatcacctgaaccatgcccatcactacacaatcgatccacatacg
gccgtggcctcggcggttgccaaacagtatcaagccgcaaccagagatcagcggcccatg
gtggttgtttcaaccgctagtccgtataaattcccacaggccgtcctaacggcaattact
ggtgagcttagtgcggtagatggcctagccgcagttgatcagttacatgagttgattcaa
acgcccattccagcaacggtcacagccctccgtactgcgcccgtgcgccataagcgggtt
gcggatgttgatgatatgggaacgaccattaaaacaattttaaatcttaactag

DBGET integrated database retrieval system