KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2478Help
Entry
LPST_C2478        CDS       T01324                                 

Gene name
pbg6
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C2478 (pbg6)
Enzymes [BR:lps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LPST_C2478 (pbg6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2653502..2654884)
Genome map
AA seq 460 aa AA seqDB search
MDKERQMPKDFFWGNSVSSMQTEGAWDEDGKGRSVYDVRPATATTSDWHDAIDEYHRYEE
DLDLMKDLHLNMYRIQISWSRVVPDGNGEFNAAGIAFYDRLVDAMLARGITPMICLYHFD
MPLALAENENGFMSRHTVDAFVRFGEKMIAHFADRVKYWIVFNEHNLYFTDEVFNISGYT
KGDQSVNDLYRIFHHTMLAHARLDDFVHQNYDDVKIGGMLAYTPVYPETAKPIDIMAARK
SDEFLNNNLNDAYVHGHYSPEVLRYVEQQGIDYDLQPGDEAIIGKMKADFLAFSYYRSTV
INGDKIPVDAVPNRYLNYSFEANRFLQANEWGWAIDPLGFRNLITKLYDQYEVPVFPIEN
GIGLREHWDGQHMIEDDERITYHEEHIKAMKDAMLIDGAKVLGYLGWGLIDIPSSHADIE
KRYGVVYVNRSNHDLKDLKRVPKKSYYWLQGVLAKNGDEL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggataaggagcgacagatgcccaaggattttttctggggcaattcagtgtcaagtatg
caaactgagggtgcttgggatgaagacggtaagggtcgttcagtttatgatgttcgtcct
gcgacagcaaccacttcggattggcatgatgccattgatgaatatcatcgttacgaggaa
gaccttgatttgatgaaggacttacatttgaatatgtatcgaattcagatttcatggtca
cgagtagttccagatggtaatggtgagtttaatgccgctgggattgcgttttatgatcgg
ctggttgatgcgatgctggcacgggggattacaccgatgatttgcctgtatcactttgat
atgccgttagccttagctgaaaatgaaaacgggttcatgtcgcgccacaccgttgatgcg
ttcgtccgttttggtgaaaagatgattgcccactttgctgaccgggttaaatattggatc
gtgttcaatgaacataatttatactttaccgacgaagtcttcaacatttcagggtacacc
aagggtgatcaaagtgttaacgacttataccggattttccaccatactatgttagcgcac
gcgcgcctagatgactttgttcatcagaactacgatgacgtgaagattggtggtatgtta
gcttacaccccggtttatccagaaacagctaagccaattgatattatggcggctcgtaag
agtgacgaatttttgaacaacaacttgaatgacgcttacgtgcacgggcactattcacca
gaagtcctgcgttacgttgaacaacagggcatcgattatgatttgcaaccaggtgatgaa
gcaatcattggcaaaatgaaagcggattttttggcctttagttattatcgttcaacggtt
atcaacggggataaaatacccgttgatgccgttccgaatcgttatctcaattattcattt
gaggccaaccgctttttacaagctaatgaatggggctgggcgattgatccactcggtttc
cgcaacttgattaccaagttgtatgaccagtacgaagtacccgtgttcccgattgaaaat
gggattgggttacgcgagcactgggatggccagcatatgatcgaagatgatgagcggatt
acttatcatgaagaacatatcaaggcgatgaaagatgccatgttgatcgacggcgctaag
gtactaggttatctcggctggggcttgattgatattccaagttcacacgcagatatcgaa
aaacgttacggagttgtttacgttaaccggagtaatcatgatctaaaagacttaaagcgg
gttcccaagaagtcatattattggctgcaaggggtcctagcaaaaaatggagatgaattg
taa

DBGET integrated database retrieval system