KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2714Help
Entry
LPST_C2714        CDS       T01324                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2906058..2906837)
Genome map
AA seq 259 aa AA seqDB search
MNITPDSFFDGGQYKTKDDVLNHVDAMLQAGADVIEVNGQTTRPGFTEVTPQVELDRTLP
YIRAIKARFPEAVLAVDTYKYDVMQAVLEEGVSIINDVNAFTDDPRKLKLMADSRVGLLT
MHSSRDQEYTDLTSSMRGFFEQNLAALTSHGIDIERIALDQGIGYSQVAHGEQDYVMMRN
IDEFNYLRRPMMVAISRKGYLGLLLGLKKEDRLPMTLVTEAAMMLKGGRIIRVHDVAETK
QLITLLGRIENGYWLSNND
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatattacgccggactcctttttcgacggtggccagtacaagactaaagatgacgta
ctgaatcacgtggatgccatgttacaagcaggagctgacgtaatcgaagttaatggtcaa
acgacacggccgggcttcacggaagtcacgccgcaagttgaattagaccggacgttgccg
tacattcgcgccatcaaggctcgtttcccggaagcagtcttagcggtcgatacttataag
tatgatgtcatgcaagccgtcctggaagaaggtgtcagcattattaacgatgtgaacgcc
tttacggacgaccctcgcaagctcaaattgatggctgacagtcgcgtcggcttactgact
atgcacagtagtcgtgaccaagaatataccgatctgacgagcagtatgcgtggtttcttt
gaacaaaatctggcagcattgacgagtcatggcatcgatattgaacgaattgctctagat
cagggaatcggctattcacaagtcgcacatggggaacaggattacgtgatgatgcgtaac
attgatgaatttaattatttgcgacgcccaatgatggtggccatttcacggaaaggttat
ttaggtctattgcttggtctgaagaaggaagaccggctaccaatgacgttggtcactgaa
gcagcgatgatgcttaagggtggccggatcatccgggtccacgatgtggctgaaaccaag
caattgattacgctgttaggccgaattgagaatggctattggttatcgaataatgattag

DBGET integrated database retrieval system