KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2840Help
Entry
LPST_C2840        CDS       T01324                                 

Gene name
lacA
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lps00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3039844..3041895)
Genome map
AA seq 683 aa AA seqDB search
MSNPLKTTEFLHGGDYNPDQWLDQPEVIKQDFKAFKAAKLNTVTLGIFAWDKLEPAEGQY
DFSWLDQIFDRAEAQGTKIILSTPSGARPRWLAEKYPEVLRVNEHGQRNQFGERHNHCYT
SPVYREKVQMINQKLAERYGQRPSLLLWHISNEYGGACYCDLCQQAFRHWVQKKYQTLAN
LNHAYCGAFWSHDYTSWDQVQAPSPLGDTNVMGLNLDWHRFVTDRTIDFFDNEIKPLRAL
TPNIPVTANFMGGNPSESHVFYDLDYQKFAKHVDIVSWDSYPNWSNGYESTAHLAMKTAL
MNDVMRSLKHDNYLIMESTPSQVNWHPYNRAKRPGMHEMGSLQQVAHGADSVLYFQLHQS
LGASEMFHGAVIANHCGSNTRAFKDVQKVGQDLQSLQAAHGTTRTAAKVAIVFDYDNMWG
LDDARNYANETKKYWRTIQEHYQYFWKHDIPVEIIATTDDLTAYDLVIDPMHFMMSAQFA
TKLKAYVQQGGHLIGTYITGVVDHDFLAYQGDGLADLEATYGIKVQETDTLYPQQHNALT
AYHQAYQVNDYCDVVETTTAQVLGTYQKDFYAGTPAVTVNQLGQGAAYYLAARTDTDFLD
AFYERLATSLALKPALPVIKANAKVSIQVRENATTRYYFVINFSHRPTTVTLEVPLRQIF
ENQVVSGKQDLASYGVQVYMMNK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccattaaagacaacagaatttttgcatggtggtgattataatccagaccag
tggcttgaccaacccgaggtgattaagcaggattttaaagcgtttaaggctgctaagtta
aatacggtgacattgggaatctttgcttgggacaagttagagcctgctgaggggcagtat
gattttagctggttagatcaaattttcgatcgtgccgaagcccaagggactaagatcatt
ttgtcgacgccaagcggggctcgtccacgctggttagctgagaaatatccagaagtgtta
cgtgtcaatgaacacggacagcgaaatcaattcggcgagcgacataatcactgttacaca
tcgccagtttaccgagaaaaggttcaaatgattaaccagaagttggcggaacgttacggt
caacgaccaagcttgctgctatggcatatctctaatgaatatggcggtgcttgttactgt
gatttgtgccagcaagcctttcgtcattgggttcaaaaaaagtatcaaacgttagccaat
ttgaaccatgcttactgtggtgctttttggagtcacgattatacaagttgggatcaggtt
caggcaccgtctccgctgggtgatacgaatgtaatgggacttaacctggattggcatcgt
tttgtaacagaccggacgattgacttttttgataatgaaattaaaccgttacgagcgctg
acacctaatatccctgtgacagccaattttatgggtggcaacccatcagaatcacacgtc
ttttatgatttagattatcagaagtttgcgaagcatgtcgatattgtgagttgggattca
tatcctaattggagtaatggttacgaaagtacggcccacttggccatgaaaactgctttg
atgaatgacgtgatgcggagcctcaagcatgataactacttgattatggaaagtacaccg
tcacaggttaattggcacccatataatcgtgccaaacgaccaggcatgcacgaaatgggg
agcttgcaacaggttgcccatggtgccgactcagttttgtatttccaactacatcaatca
ttaggagcttctgaaatgtttcatggcgccgtcattgccaaccattgtggctcaaatacg
cgggcatttaaggacgttcaaaaagttggtcaggacttacaaagcttacaggccgcgcat
ggaacgaccagaactgcagctaaagtcgctattgtctttgattatgacaacatgtggggc
ttagatgatgcccgcaactacgctaacgaaactaaaaagtattggcgcacgattcaagaa
cattaccagtatttctggaaacatgatattccagttgaaattattgcgactactgatgat
ttgacggcctatgatttggtgattgatccgatgcacttcatgatgagcgcccagtttgcg
actaagcttaaagcatatgtgcaacagggcggccatctgatcggcacctatattacgggc
gtcgttgatcatgacttcttagcctatcaaggtgatgggttagctgacttagaagcaact
tacggaattaaagttcaggaaactgacacattatatccgcaacaacataatgcactgact
gcttatcaccaagcgtatcaagtgaatgattattgtgatgtagttgagacgacaacggca
caagtcctcggcacgtatcaaaaagacttttatgctggaacaccggctgtaacggtcaat
caattgggccagggagcggcgtattatttggctgcgcggaccgatactgacttcttggat
gctttctatgaacggcttgccacaagtttggcacttaaaccggccttgccagtgatcaaa
gcgaatgccaaggtaagtattcaagttagagagaatgcgacgacgcgctattacttcgtg
atcaattttagtcatcgaccaacgacggtgacacttgaagtgccgttacggcagattttt
gagaatcaagtggtcagtggcaagcaagacttggccagctatggtgttcaagtctatatg
atgaataaataa

DBGET integrated database retrieval system