KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2855Help
Entry
LPST_C2855        CDS       T01324                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LPST_C2855 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LPST_C2855 (melA)
   00600 Sphingolipid metabolism
    LPST_C2855 (melA)
Enzymes [BR:lps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LPST_C2855 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3059986..3062202)
Genome map
AA seq 738 aa AA seqDB search
MAVTLQQTLIDIDEEQLVFHLHNDQISYILGVETGNVLAHLYFGPRVRGYHGERQYPRID
RGFSGNLPNTTDRSYSKDDLPQEYGGNNTGDYRQPAAIIRAANGARTVDFRYQDCRMEAG
KPELKGLPQTYVEDEDEAQTLIVTLRDATLGVTLELAYTIYRDRPVITRSARLINHSEQA
VDLEKVASMQMDLPTQPLDAISLPGSYARERQLSRERLHRGVTQFESRRGASSHHMNPFV
ALADPNTNEFQGNVLGALLIYSGNHQISLERDPIGQTRLTMGINEYNFDWRLAADDSFQT
PEVAMVYSTTGLNGMSQTYHDLLRDRVARSRYKHDLRPILINNWEATYFDFDADKIQSIL
DAAAPLGIEMFVLDDGWFGHRNDDNSSLGDWFVNRNKLPGGLADISKRTHDKGMRFGLWF
EPENISADSDLYRAHPDWVLGVPDRGRTLSRNEYVLDFSQPDVVDNIFEQMTAVLDKVPI
DYIKWDMNRNLTEVYSPHSDSTHEGETSHRFILGVYDLMERLTKRYPQILFEGCSGGGGR
FDAGLMYYMPQSWPSDNNDPIERLKIQYGTSLVYPISAITAHVGTSPDELLGRSTSMKMR
GAVAMSGTLGYELDAAQLSDADKQAVKRQVAFYKQHRELVQYGAFYRLESPFESNTVAWM
FVSPDQKEALLFTFVILGAVQPEPHITKLAGLDPQQTYVETDTNKMYGGDELMQLGLYTT
PVQTSDFTAQVHYFKAKD
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacgttgcagcaaactttaattgacattgatgaagaacaacttgtctttcac
ctgcataacgatcaaatctcgtatattctaggtgtggagacaggcaacgtgttggcccac
ttgtactttggcccacgggttcggggttatcatggcgagcgtcagtatccccggattgat
cgggggttctcaggaaatttaccgaatacgactgatcgaagctattccaaggatgatttg
ccacaggaatacggtggcaataataccggtgattatcggcaacccgccgcgattattcgc
gcggccaatggtgctcgaacagttgattttcgctatcaagactgccggatggaagccggt
aagccggaacttaagggcttgccacaaacttatgtcgaagatgaggatgaagcccaaact
ttgattgtgacgttgcgagatgccacattaggcgtgacactcgaattagcctacacgatt
tatcgggatcggccagttatcacgcgtagcgcccggttgattaatcacagtgagcaagct
gtcgacttagaaaaagtggcttcgatgcagatggacctgccaacccaaccattagatgcc
atttcgttacctggaagctatgcgcgtgagcgccagcttagtcgtgaacggctccatcga
ggtgtaactcagtttgaaagtcgccggggtgctagttctcatcatatgaatccttttgtg
gcgctagctgatccgaatactaatgaatttcaaggcaatgtccttggtgcattgctaatt
tattcaggtaaccaccagattagtttagaacgggacccaattggtcagacacgcttgact
atgggaatcaatgaatataacttcgactggcgattggcggccgatgatagtttccaaacg
cccgaggttgcaatggtatactcgacgacggggcttaatggtatgtcgcaaacctaccat
gatttattgcgtgatcgcgtggcgcgcagtcgttacaagcacgatctccggccgatcttg
atcaacaattgggaagccacttactttgactttgatgcggacaagattcaatcaatcttg
gatgctgcagcaccactgggtatcgaaatgtttgtgctggatgacggttggttcggtcat
cgaaatgatgataatagttcgctaggtgactggtttgttaatcggaacaagttaccagga
ggcttagcggatattagcaaacggacccatgataaagggatgcggttcggactttggttc
gagccagaaaatatttcagccgattccgatctttatcgggcccatcctgattgggtgtta
ggcgtaccagatcgtggccgaacgttatcgcggaacgaatacgtgcttgatttcagccag
ccggatgttgtcgacaatatttttgaacaaatgaccgcagttcttgataaggtgcccatt
gattatatcaagtgggatatgaaccgcaatttaacggaagtctattcgccacatagcgat
tcaactcatgaaggtgagactagccaccgctttatcttaggtgtatatgacttgatggag
cgtttaacaaaacgctatccacagatcttatttgaaggctgctctggcggtggtggccgc
tttgatgctggtttaatgtattatatgccacagagttggccatcagataataatgacccg
attgaacggctcaaaattcaatatgggacttcactcgtttatccaatttctgcaattacc
gcccatgttgggacgagcccggatgaattgttaggacggtcgacgtcgatgaagatgcgt
ggtgctgtggcaatgagtggtaccttgggctatgaactggacgcggcccaactaagtgat
gcggacaagcaggccgttaaaagacaggttgccttctataagcagcaccgtgagttagtt
caatacggggccttttatcgattagagagcccgtttgaatctaatacggtggcgtggatg
tttgttagtccggatcagaaagaagccttgctgttcaccttcgttattttaggtgcagtt
caaccagaaccgcatattacgaagttagcgggattagaccctcagcagacctacgttgag
accgacacaaacaaaatgtacggtggcgatgaattgatgcaactaggactctacacgact
cccgttcaaactagtgactttacggcgcaggtacattacttcaaggctaaggactaa

DBGET integrated database retrieval system