KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2877Help
Entry
LPST_C2877        CDS       T01324                                 

Gene name
pbg9
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lps00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3088708..3090156)
Genome map
AA seq 482 aa AA seqDB search
MSEFPEGFLWGGATAANQLEGGYQEGGRGLSIADALPGGKDRFKIVSQPDFDWTIDTDKY
TYPNHEGIDFYHHYKEDIALFAEMGFKCYRFSIAWSRIFPNGDETQPNEAGLKFYDDVID
ECLANNIEPVITISHYELPLNLAKRYGGWKNRYLIEFYETFARTILTRYASKVKYWMTFN
EINSAAHFPVMGQGLVPSTGANDKKNVFQAWHNQFVASAKAVKIAHELRDDIQVGCMILY
ATSYAYDSNPVNQLANLQHNQDFNFFCADVQVRGAYPTYTKRLLAEYNLTFDDLETTDGD
LALLQQYPVDYIGFSYYMSSAVETTGSVTDTVAGNLMGGVKNPFLKASDWGWQIDPTGLR
IALNELYDRYQKPLFVVENGLGAIDKPDKNFYVEDDYRIDYLKQHIEAMAGAIDDGVDLM
GYTPWGCIDLVSASTGEMSKRYGFIYVDLDDQGHGTLARYPKKSFYWYQDVIKHNGLAEK
SE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagttcccagaaggatttctatggggcggcgcgactgctgccaatcagttagag
ggtggctaccaagaaggtggtcgtggcttatcgattgcggatgcgttaccaggtggcaaa
gaccgatttaaaatcgttagtcaaccagattttgactggacgatcgatacagataagtac
acctatccaaaccatgaaggtattgatttctatcatcattacaaagaagatattgcactg
tttgccgaaatgggtttcaagtgttaccgtttctcaattgcatggtcacgaatttttcca
aacggtgatgaaacgcaacctaacgaagccggattaaagttttatgatgatgtgattgac
gaatgcttggctaataatattgaaccagtgattacaatctcacattatgaattgccattg
aacttggccaaacggtatggtggctggaagaaccggtatttgattgaattctacgaaact
ttcgcgcggaccatcttaacgcgttatgcttcaaaggttaagtactggatgaccttcaac
gaaatcaatagtgcggcacattttccggtgatgggccaaggattagtgccatcgacgggt
gctaatgacaaaaagaacgtttttcaggcatggcacaatcagtttgtggccagtgctaag
gcagtcaaaatcgcccacgaattgcgagacgatattcaggttggctgtatgattctctat
gccactagttatgcttatgattcgaacccagttaaccagctggctaatttgcagcataat
caagatttcaacttcttctgtgcggatgttcaagtacgtggagcttatccgacctatacc
aagcgactgctggctgaatataatctgacctttgatgatctggagaccacggatggcgac
ttggcattactacaacaatatccagttgattatattgggtttagttattatatgtcgagc
gcggtggaaaccacgggtagtgtaaccgatactgttgctggtaacctgatgggcggcgtc
aagaatccatttttgaaggcgagtgactggggttggcagattgacccaaccgggttacgg
attgcgttaaatgagctatatgatcgctatcagaaaccgttgtttgtggttgaaaatggc
ctaggtgcgattgataaacctgataagaatttctatgttgaagatgattatcgcattgat
tatttgaagcaacatattgaagcgatggctggtgccattgatgatggcgtcgatttgatg
ggctacacaccatgggggtgcatcgaccttgttagtgcatcaactggcgagatgagtaag
cggtatggctttatttacgtggacctagatgatcagggccacgggacgttagctcgctat
cccaagaagtcgttctactggtatcaagatgtgattaagcataatgggttagcggagaaa
tctgaatag

DBGET integrated database retrieval system