KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2900Help
Entry
LPST_C2900        CDS       T01324                                 

Gene name
xpk2
Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPST_C2900 (xpk2)
Enzymes [BR:lps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LPST_C2900 (xpk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3118358..3120769
Genome map
AA seq 803 aa AA seqDB search
MQRSCKIMSEAIKSKTVDYSSDEYLKRVDEYWRAANYISVGQLYLLNNPLLREPLKATDV
KVHPIGHWGTIAGQNFIYAHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYP
KITQDKAGMKRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPGLIAA
TVVGDGESETGPLATSWQVNKFLNPITDGTVLPILNLNGFKISNPTVLSRESHEELEDYF
KGLGWDPHFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAKDNNDESRPKWPMIVFRAPK
GWTGPKSWDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLKPEI
AAIIPEGQARMAANPVTNGGKLTKDLITPNIDDYALDNKDHGKEDGSDMTELGKYIRDLI
ELNKDNKNFRGWGPDETLSNKLGAAFEDTKRQWMEPIHEPNDALLAPQGRIIDSMLSEHM
DEGMLEAYNLTGRYGFFASYESFLRVVDSMLTQHFKWLRNSHEETPWRADVPSLNVIASS
TAFQQDHNGYSHQDPGIISHLAEKKTEYVRAYLPGDANTLIATFDKAIQSKQLINLIIAS
KHPRPQWFTMDEAKRLVRDGLGVVDWASTDHVEEPDVVFATAGSEPTTESLAAVSILHAR
FPEMKIRFINVVDLLKLKKDDPRGLSDAEFDAFFTKDKPVIFAYHAYDDLVKTIFFDRHN
HNLHVHGYREEGDITTPFDMRVRNELDRFHLVKAALLATPAYAEKGAHVIQEMNSILDKH
HDYIRAEGTDIPEVENWKWTALK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaggagttgcaaaataatgagtgaagcaattaaatccaaaacagttgattactct
tctgatgaatatctaaaacgcgttgatgaatattggcgtgctgctaactacatctcagtt
ggtcaactctatctactaaataacccgttacttcgggaaccactaaaggcgaccgacgtg
aaagttcatccaatcggccattggggcacgattgctggtcaaaactttatttatgcccat
ttaaaccgggcaatcaataagtatggcttgaacatgttctacattgaaggccctggtcat
ggtggtcaagtaatggtttctaactcctacttagatggcacctatacggaaacgtatcct
aaaatcacccaagacaaagctgggatgaaacgcttattcaagcaattctcattcccaggc
ggggttgcttcccatgccgatcctaagacgcctggttcgatccatgaaggtggcgaactt
ggctactcaatcctgcatggtgctggtgcagtattagataatccaggtttaattgccgct
accgttgttggtgatggtgaatctgaaactggaccattggcaacttcttggcaagttaac
aagttccttaacccaattacagacgggacagtcttaccaatcttgaacttaaacggcttc
aagatttctaatccaacagttctttcacgtgaatcacatgaagaacttgaagactacttt
aaaggtctaggctgggatccacactttgttgaaggtacagaccctgccaagatgcacaaa
atcatggctgaagaattggataaagtcattgaagaaatccacgcaattcgtaagaacgcc
aaggataacaatgatgaatctcgtcctaagtggccaatgattgttttccgggcacctaag
ggctggaccggtcctaagagttgggacggcgaaccaattgaaggttcattccgggctcac
caaattccaattcctgtcgatcgcaatcacatggaacacgccgacaaattagttgactgg
ctcaaatcatacaaaccagaagaattatttgatgaaaatggtactttaaaaccagaaatt
gccgcaatcatccctgaaggccaagctcgtatggctgctaaccccgtcactaacggcggt
aagttaactaaagacttaattacaccaaatatcgatgattatgctttggacaacaaggat
cacggtaaggaagacggttcagacatgactgaacttggtaagtatatccgtgatttaatt
gagttgaacaaagacaacaagaacttccgtggctggggtcctgacgaaaccttatctaac
aaactaggcgctgcttttgaagataccaaacgtcagtggatggaaccaatccacgaacct
aatgatgctttgttagcacctcaaggccggattattgactccatgttgtcagaacacatg
gatgaagggatgttggaagcttacaatttaaccggacgttacggtttcttcgcaagttat
gaatcattcctgcgcgttgtggattcaatgttaacccaacacttcaagtggttacggaat
tctcacgaagaaaccccttggcgggctgatgtaccttcactgaatgtgattgcatcatca
acagccttccaacaagatcacaatggttactctcaccaagatccaggtatcatttcacac
ttggctgaaaagaagaccgaatacgttcgtgcctatcttccaggtgatgccaatactttg
attgcaacctttgataaggctatccaaagcaaacaattgattaatttaatcattgccagc
aagcaccctcgtccacaatggttcacaatggacgaagctaagcgcttagttcgtgatggc
cttggtgttgttgattgggcaagcactgatcatgttgaagaacccgacgttgtcttcgca
actgccggctctgaaccaacgactgaaagcttagctgccgtatcaatcttgcatgcacgc
ttccctgaaatgaagattcgcttcattaacgttgttgatcttctgaagctgaagaaagac
gaccctcgtggtttatcagatgctgaatttgatgctttcttcactaaggacaaaccagtt
atctttgcttatcatgcatacgacgacttagtaaagaccatcttcttcgatcgccataac
cataacttacacgttcatggttaccgcgaagaaggcgacattacaacgccattcgacatg
cgtgttcgcaacgaactcgatcgtttccacttagtcaaagctgccttattagcaacgcca
gcttatgccgaaaaaggtgcccatgtcattcaagagatgaacagcattttagacaagcat
catgactatatccgtgctgaaggtaccgatattccagaagttgaaaactggaaatggact
gcattgaagtag

DBGET integrated database retrieval system