KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C2990Help
Entry
LPST_C2990        CDS       T01324                                 

Gene name
rbsK3
Definition
(RefSeq) ribokinase
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPST_C2990 (rbsK3)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LPST_C2990 (rbsK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3226390..3227310)
Genome map
AA seq 306 aa AA seqDB search
MNTVTVIGSINLDRTIRVENMPKPGETIHTKEIFSAGGGKGANQAVAAQRSGANTHFIGA
VGDDAAGKTMLDLLTQEKINLAGITKMTNQSTGQAYVTVDDAGENQIMIHGGANMAFTPA
DVEAHRDIIETSDFVVAQFESAVDSTVEAFKIAQAAGVRTILNPAPAMEKVPAELLAVTD
MIVPNETETETLTGIAITDEASMLKASAALHALGISAVIITIGSKGAFYDIDGRHGIVPA
FKVEAVDTTSAGDTFIGAMSSVLNKDFSNLEDAIRYGNRASSIAVQRFGAQPSIPYKNEI
TAAEGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggtaaccgttattgggagtatcaacttagaccggacgattcgggttgaaaac
atgccaaagcctggcgaaacgattcacactaaggaaatcttttcagccggtggtggtaag
ggcgcgaaccaggccgtcgcagcgcaacgttctggtgctaatacccactttattggtgcg
gttggtgacgatgctgctggtaaaaccatgcttgatttattgacgcaggaaaagatcaac
ttggcagggatcacaaagatgactaatcaatcgacaggtcaagcttacgtcacggttgat
gatgccggtgaaaaccaaattatgattcatggtggtgccaacatggcctttacgccagca
gacgttgaagcccaccgtgatatcattgaaactagtgattttgtggttgcacaatttgaa
agcgctgtcgatagtacggtcgaagcctttaaaattgcacaggccgctggcgtaagaaca
atcttgaatcccgctccagccatggaaaaagtccccgctgaacttttagcagttactgac
atgattgtaccaaatgagacggaaacggaaactttgactgggattgcaatcaccgatgaa
gccagcatgttaaaggcgtccgctgcattacacgccctcggtatttcagctgttatcatt
acgattggtagtaagggtgcgttttatgatatcgatgggcgacatggtatcgtaccagct
tttaaagtcgaagccgtggatacgacttcagccggagatacgtttattggcgcgatgagt
agtgtgttaaataaagattttagtaatcttgaagatgcgattcgctatggtaaccgggcg
tcatcgattgccgtacaacgtttcggtgcgcaaccatcaattccttataaaaatgaaatt
acagccgcggagggtaaataa

DBGET integrated database retrieval system