KEGG   Lactobacillus plantarum ZJ316: zj316_0114Help
Entry
zj316_0114        CDS       T02458                                 

Gene name
melA
Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt00052  Galactose metabolism
lpt00561  Glycerolipid metabolism
lpt00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    zj316_0114 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    zj316_0114 (melA)
   00600 Sphingolipid metabolism
    zj316_0114 (melA)
Enzymes [BR:lpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     zj316_0114 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: AGE37653
UniProt: M4KDC3
Position
complement(116530..118746)
Genome map
AA seq 738 aa AA seqDB search
MAVTLQQTLIDIDEEQLVFHLHNDQISYILGVETGNVLAHLYFGPRVRGYHGERQYPRID
RGFSGNLPNTTDRSYSKDDLPQEYGGNNTGDYRQPAAIIRAANGARTVDFRYQDCRMEAG
KPELKGLPQTYVEDEDEAQTLIVTLRDATLGVTLELAYTIYRDWPVITRSARLINHSEQA
VDLEKVASMQMDLPTQPLDAISLPGSYARERQLSRERLHRGVTQFESRRGASSHHMNPFV
ALADPNTNEFQGNVLGALLIYSGNHQISLERDPIGQTRLTMGINEYNFDWRLAAGDSFQT
PEVAMVYSTTGLNGMSQTYHDLLRDRVARSRYKHDLRPILINNWEATYFDFDADKIQSIL
DAAAPLGIEMFVLDDGWFGHRNDDNSSLGDWFVNRNKLPGGLADISKRTHDKGMRFGLWF
EPENISADSDLYRAHPDWVLGVPDRGRTLSRNEYVLDFSQPDVVDNIFEQMTAVLDKVPI
DYIKWDMNRNLTEVYSPHSDSTHEGETSHRFILGVYDLMERLTKRYPQILFEGCSGGGGR
FDAGLMYYMPQSWPSDNNDPIERLKIQYGTSLVYPISAITAHVGTSPDELLGRSTSMKMR
GAVAMSGTLGYELDAAQLSDADKQAVKRQVAFYKQHRELVQYGTFYRLESPFESNTVAWM
FVSPDQKEALLFTFVILGAVQPEPHITKLAGLDPQQTYVETDTNKMYGGDELMQLGLYTT
PVQTSDFTAQVHYFKAKD
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacgttgcagcaaactttaattgacattgatgaagaacaacttgtctttcac
ctgcataacgatcaaatctcgtatattctaggtgtggagacaggcaacgtgttggcccac
ttgtactttggcccacgggttcggggttatcatggcgagcgtcagtatccccggattgat
cgggggttctcaggaaatttaccgaatacgactgatcgaagctattccaaggatgatttg
ccacaggaatacggtggcaataataccggtgattatcggcaacccgccgcgattattcgc
gcggccaatggtgctcgaacagttgattttcgttatcaagactgccggatggaagccggt
aagccggaacttaagggcttgccacaaacttatgtcgaagatgaggatgaagcccaaact
ttgattgtgacgttgcgagatgccacattaggcgtgacactcgaattagcctacacgatt
tatcgggattggccagttatcacgcgtagcgcccggttgattaatcacagtgagcaagct
gtcgacttagaaaaagtggcttcgatgcagatggacctgccaacccaaccattagatgcc
atttcgttacctggaagctatgcgcgtgagcgccagcttagtcgtgaacggctccatcga
ggtgtaactcagtttgaaagtcgccggggtgctagttctcatcatatgaatccttttgtg
gcactagctgatccgaatactaatgaatttcaaggcaatgtccttggtgcattgctaatt
tattcaggtaaccaccagattagtttagaacgggacccaattggtcagacacgcttgact
atgggaatcaatgaatataacttcgactggcgattggcggccggtgatagtttccaaacg
cccgaggttgcaatggtatactcgacgacggggcttaatggtatgtcgcaaacctaccat
gatttattgcgtgatcgcgtggcgcgcagtcgttacaagcacgatctccggccgatcttg
atcaacaattgggaagccacttactttgactttgatgcggacaagattcaatcaatcttg
gatgctgcagcaccactgggtatcgaaatgtttgtgctggatgacggttggttcggtcat
cgaaatgatgataatagttcgctaggtgactggtttgttaatcggaacaagttaccagga
ggcttagcggatattagcaaacggacccatgataaagggatgcggttcggactttggttc
gagccagaaaatatttcagccgattccgatctttatcgggcccatcctgattgggtgtta
ggcgtaccagatcgtggccgaacgttatcgcggaacgaatacgtgcttgatttcagccag
ccggatgttgtcgacaatatttttgaacaaatgaccgcagttcttgataaggtgcccatt
gattatatcaagtgggatatgaaccgcaatttaacggaagtctattcgccacatagcgat
tcaactcatgaaggtgagactagccaccgctttatcttaggtgtatatgacttgatggag
cgtttaacaaaacgctatccacagatcttatttgaaggctgctctggcggtggtggccgc
ttcgatgctggtttaatgtattatatgccacagagttggccatcagataataatgacccg
attgaacggctcaaaattcaatatgggacttcactcgtttatccaatttctgcaattacc
gcccatgttgggacgagcccggatgaattgttaggacggtcgacgtcgatgaagatgcgt
ggtgctgtggcaatgagtggtaccttgggctatgaactggacgcggcccaactaagtgat
gcggacaagcaggccgttaaaagacaggttgccttctataagcagcaccgtgagttagtt
caatacgggaccttttatcgattagagagcccgtttgaatctaatacggtggcgtggatg
tttgttagtccggatcagaaagaagccttgctgttcaccttcgttattttaggtgcagtt
caaccagaaccgcatattacgaagttagcgggattagaccctcagcagacctacgttgag
accgacacaaacaaaatgtacggtggcgatgaattgatgcaactaggactctacacgact
cccgttcaaactagtgactttacggcgcaggtacattacttcaaggctaaggactaa

DBGET integrated database retrieval system