KEGG   Lactobacillus plantarum ZJ316: zj316_0199Help
Entry
zj316_0199        CDS       T02458                                 

Gene name
rbsK3
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    zj316_0199 (rbsK3)
Enzymes [BR:lpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     zj316_0199 (rbsK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216201..217121)
Genome map
AA seq 306 aa AA seqDB search
MNTVTVIGSINLDRTIRVENMPKPGETIHTKEIFSAGGGKGANQAVAAQRSGANTHFIGA
VGDDAAGKTMLDLLTQEKINLAGITKMTNQSTGQAYVTVDDAGENQIMIHGGANMAFTPA
DVEAHRDIIETSDFVVAQFESAVDSTVEAFKIAQAAGVRTILNPAPAMEKVPAELLAVTD
MIVPNETETETLTGIAITDEASMLKASAALHALGISAVIITIGSKGAFYDIDGRHGIVPA
FKVEAVDTTSAGDTFIGAMSSVLNKDFSNLEDAIRYGNRASSIAVQRFGAQPSIPYKNEI
TAAEGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggtaaccgttattgggagtatcaacttagaccggacgattcgggttgaaaac
atgccaaagcctggcgaaacgattcacactaaggaaatcttttcagccggtggtggtaag
ggcgcgaaccaggccgtcgcagcgcaacgttctggtgctaatacccactttattggtgcg
gttggtgacgatgctgctggtaaaaccatgcttgatttattgacgcaggaaaagatcaac
ttggcagggatcacaaagatgactaatcaatcgacaggtcaagcttacgtcacggttgat
gatgccggtgaaaaccaaattatgattcatggtggtgccaacatggcctttacgccagca
gacgttgaagcccaccgtgatatcattgaaactagtgattttgtggttgcacaatttgaa
agcgctgtcgatagtacggtcgaagcctttaaaattgcacaggccgctggcgtaagaaca
atcttgaatcccgctccagccatggaaaaagtccccgctgaacttttagcagttactgac
atgattgtaccaaatgagacggaaacggaaactttgactgggattgcaatcaccgatgaa
gccagcatgttaaaggcgtccgctgcattacacgccctcggtatttcagctgttatcatt
acgattggtagtaagggtgcgttttatgatatcgatgggcgacatggtatcgtaccagct
tttaaagtcgaagccgtggatacgacttcagccggagatacgtttattggcgcgatgagt
agtgtgttaaataaagattttagtaatcttgaagatgcgattcgctatggtaaccgggcg
tcatcgattgccgtacaacgtttcggtgcgcaaccatcaattccttataaaaatgaaatt
acagccgcggagggtaaataa

DBGET integrated database retrieval system