KEGG   Lactobacillus plantarum ZJ316: zj316_0201Help
Entry
zj316_0201        CDS       T02458                                 

Gene name
adhE
Definition
Bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    zj316_0201 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zj316_0201 (adhE)
   00620 Pyruvate metabolism
    zj316_0201 (adhE)
   00650 Butanoate metabolism
    zj316_0201 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    zj316_0201 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    zj316_0201 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    zj316_0201 (adhE)
   00626 Naphthalene degradation
    zj316_0201 (adhE)
Enzymes [BR:lpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     zj316_0201 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     zj316_0201 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218483..221155)
Genome map
AA seq 890 aa AA seqDB search
MSKDGYNKVCKLIHKGIERRKHFMIKTEKNQTSKVTDEVDQLVQRSKKALAILKSYTQAQ
IDDLCEKVAVAALDNHMKLAKLAVEETGRGVVEDKAIKNIYASEYIWNSMRHDKTVGVIK
EDDEEQLMEIAEPVGIVAGVTPVTNPTSTTVFKTLISLKGRNTIVFGFHPQAQKCSSAAA
DVMREAIKAAGGPADAVLYIEHPSIEATDALMHHTDVATILATGGPSMVTAAYSSGKPAL
GVGPGNGPTYVEKTADIKQAVNDIVLSKTFDNGMICASENSAIIDKEIYAEVKAEFIRLG
CYYVKPKDVQALSDAVIDPNRHTVRGPVAGKTAYQIAQMAGLKDVAKDCRVLIAEINGVG
IKYPLSGEKLSPVLTVYKADSHEAAFKRANELLHYGGLGHTAGIHTTDDALVKEFGLQMP
ACRILVNTPSSVGGLGNIYNNMAPSLTLGTGSYGGNSISHNVTDMDLINIKTVAKRRNNM
QWVKMPPKVYFERNSVRYLEHMAGIKKVFLVCDPGMVEFGYADRVTAVLNKRTDPVDIDI
FSEVEPNPSTDTVYKGVARMKAFKPDTIIALGGGSAMDAAKGMWLFYEHPEASFLGAKQK
FLDIRKRTYKVPVSEKVTYIGIPTTSGTGSEVTPYAVITDSKTHVKYPITDYAMQPDIAI
VDPQFVETVPKRTTAWTGLDVITHATEAYVSTMASDFTRGWSIQALQLAFKYLKASYDGD
KMAREKMHNASTLAGMAFANAFLGINHSIAHKLGGEFNLPHGLAIAITYPQVVRYNAEIP
TKLAMWPKYNHNTALADYANIARALGLPGKTDEELKESLVKAYIDLAHSMDVTLSLKANR
VEKKHFDATVDELAELAYEDQCTTANPREPLISELKAIIEREWDGQGTEK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggatggctataataaagtttgtaaattaattcacaaaggaattgaacggagg
aagcacttcatgattaagacagaaaaaaatcaaacaagcaaagttactgatgaagttgat
caattagttcaacgttctaagaaagcattagctattttgaagtcatatacccaagcacaa
atcgatgatttatgtgaaaaggttgcggttgccgcactggacaatcatatgaagttagcc
aagttggcggttgaggaaaccggtcggggtgttgttgaagataaggcgattaagaacatc
tacgccagcgaatatatctggaacagcatgcgccatgataagacagtcggcgtcattaaa
gaagacgatgaagagcaactaatggaaattgctgaaccagttggtatcgtagccggggtt
acacccgtaacgaatccaacttcaacaacggttttcaagacgttgatctcattaaagggg
cgtaacacgatcgtctttggtttccatcctcaagctcagaaatgtagttctgcggctgct
gatgtgatgcgggaagcgattaaagctgctggtggtccagctgatgctgttttatacatc
gaacacccaagcattgaagcaaccgacgccttgatgcaccatacggatgttgcgacgatc
ttggctaccggtggtccaagtatggtgacagccgcttactcatcaggtaaaccagcactg
ggtgttggtcctggtaacggcccaacttatgttgaaaaaacagctgacattaagcaggcg
gttaacgacattgttttatcgaagacgtttgataatgggatgatttgtgcttctgaaaat
agtgccattatcgacaaggaaatttatgctgaagttaaagctgaatttattcgtttgggt
tgctactacgttaaacctaaagatgtgcaagccttgagtgatgctgtcattgatcctaac
cggcacacagttcgtggtccagttgctggtaaaacagcttatcaaatcgcacaaatggct
ggcttgaaagatgtcgctaaggactgccgggtcttgattgcggagattaatggtgtcggt
atcaagtacccattatccggcgaaaaattatcaccagttctgaccgtttacaaagcggat
tcgcatgaagcggcgttcaaacgggctaatgaattacttcactatggtggcttaggccat
actgctgggattcatacgaccgatgatgcattggtcaaagaatttggcttacaaatgcca
gcttgccggatcttagttaacacgccatcttcagttggtgggttaggtaacatctacaat
aacatggcgccttcattaactctgggcacgggatcatatggtggcaactcgatttctcat
aacgttacagatatggatctgattaatatcaaaactgtggcaaaacggcgtaataacatg
caatgggtcaaaatgcctcccaaagtctacttcgaacgcaattccgttcgctacttggaa
cacatggccgggattaagaaggttttcctagtttgtgatcctgggatggttgaatttggc
tatgctgatcgagtaacggcggtcttgaacaagcggactgatccggttgatatcgacatc
ttctcagaagttgaaccgaacccgtcgactgacacagtctacaaaggggttgcccggatg
aaggcctttaagccagatacaatcattgcactcggtggtggttctgcaatggacgccgct
aaggggatgtggctcttctatgaacacccagaagcttccttcttaggtgctaaacagaag
ttcctggatatccggaagcggacgtacaaagtaccagtatccgaaaaagtaacttatatt
gggattccaacgacttctgggactggttctgaagtaacgccatacgcggttattacggac
tccaagacgcacgtcaaatacccgattacggactacgcaatgcaaccagatattgcgatc
gttgacccacaatttgttgaaacggtgccaaagcggacgacggcttggactggtctcgac
gtaattacccacgcaaccgaagcatatgtttcaacgatggcttctgacttcacacgcggc
tggtcaattcaagctttgcaattagccttcaagtacttgaaagcttcttatgatggtgac
aagatggctcgtgagaagatgcacaatgcctcaacgctagctgggatggcctttgccaat
gccttcttgggtatcaaccactcgatcgcccataaattaggcggggaattcaacttacca
cacggattggcaattgcgatcacttatccgcaagtcgttcgttacaatgctgaaatccca
acgaagttagcaatgtggccgaagtacaaccataatactgccttagccgactatgccaac
attgcccgggccttagggttaccaggcaagaccgacgaagaactcaaagaaagcttagtt
aaagcttacattgacttggctcattcaatggatgtgaccttatccttgaaagccaaccgg
gtcgaaaagaagcactttgacgccaccgtcgacgaattagccgaactggcctatgaagac
caatgcacgaccgctaacccacgcgaacctttaatcagtgaattaaaggcgattattgaa
cgtgaatgggacggccaaggtactgaaaaatag

DBGET integrated database retrieval system