KEGG   Lactobacillus plantarum ZJ316: zj316_0391Help
Entry
zj316_0391        CDS       T02458                                 

Gene name
melA
Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    zj316_0391 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    zj316_0391 (melA)
   00600 Sphingolipid metabolism
    zj316_0391 (melA)
Enzymes [BR:lpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     zj316_0391 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(416950..419109)
Genome map
AA seq 719 aa AA seqDB search
MPVEYDPKTGLINLHNDQISYVIQILAHRYPVHRYFGRYFSKQPYFEPMPSGSHAFANDP
TERFPYSVTSLPLEYSTIGSGDYRQPAYVIKDANNQLLPILEYTGFSVNDQPINSRQLPP
TVSKHTPVTTLVIHLADSVTKLQMDLNYTIFENQPLILRSTTLRHHGTTNLQVTALSSAQ
LDLPTDQYTALTLSGTHAHEANPSFNRLHPGLQTVRSLRGTSGPQHQPFMALAEPNTTEL
AGTVIGCALAWSGNFDSTVEVDQYQHSRLTIGLEPDTFEWQLKPNSSFQTPEAVLTWTNT
GFNGMSQVFHDFSHQLMPSQTNIPSVLNTWETLTFAVSESKVQHLIEHAHQLGLQMLVLD
DGWFVNRNGENGQLGDWYVDPIKFPNGLKPLAQQAHHHRMKFGLWVEPEMITTNSQLYQQ
HPDWVLQYVDRTPITARHQLVLDLSQAAVRDHLVTTLTNLVQNNQLDYFKWDMNRHLTQV
GSTRLPAAQQGELYYRYVCGIYDILTRLKRACPKLIIENCSAGGGRFDFGMLPYTNQTWI
SDLTDPVDRATIENGFSYLFPPRIFSNHITASPNAQNGRITPFETRLQLACIGQLGLELN
PKQLAPSEQQLLRGALIKYQQLKSTFIKAHFYRLPTTRHVVAWLLVTADKKQAICCYLNG
LNSAVKTQHPLPLHYLDAELTYSDSSGNSYTGHQLNTMGIPLKPTNADFTSQLIYLRQS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgaatatgaccccaaaaccggcttaatcaatcttcataatgaccaaattagc
tatgttattcaaattttagcccatcgttacccagtgcatcgatattttggacgttacttt
tcaaaacaaccgtactttgagccgatgccatccggtagccatgcttttgctaatgaccca
acagaacgctttccatattccgtgacttcactgccactcgaatattccactattggcagt
ggtgactatcgccagccagcttacgttattaaggatgctaacaatcaattactgccaatt
ttagaatataccggtttttctgtgaatgatcagccaatcaactcgcgccaattgccaccc
accgttagcaaacacacgcctgtaacaaccctagtcattcatttggccgattcagtgacc
aagttacagatggatcttaactacactatttttgaaaatcagccgcttatcttgcgaagc
acaactctgcgccatcacggcactactaatttgcaagtaacagccctatccagcgctcaa
ctagatctaccaactgaccaatatactgcgctgacattaagcggtacccatgcacatgaa
gctaatccatcgtttaaccgtttacacccagggttacaaacggttcgcagtctgcgcggc
actagtggaccacaacaccaaccgttcatggctctagcagaacctaacacgacagaatta
gctgggactgttattggttgtgcactagcatggagtggtaacttcgacagtactgtcgaa
gttgaccaatatcaacatagccgcctaacaatcggtcttgaaccagatacattcgaatgg
cagctcaaaccaaatagcagttttcagactcctgaagccgtgctaacttggacaaatact
ggttttaacggcatgtcacaagtatttcacgactttagccatcagctgatgccctcccag
actaacattccaagtgtgcttaacacttgggaaacactgacatttgccgtttcagagtct
aaagttcaacacttaatcgaacacgcccaccagttaggcttacaaatgcttgtcttagac
gacggctggtttgtcaaccgtaacggtgaaaatgggcaattaggtgactggtatgttgac
cccattaagtttcctaatggtctgaaaccccttgcccaacaagcccatcatcatcgaatg
aaattcggtctctgggtggaaccagaaatgatcaccactaacagccagctttaccaacaa
catcctgactgggtattacaatatgttgatcggacacccatcacagctcgccaccagcta
gtcttagatctttcgcaggctgctgtccgtgaccacttagtcactactctgacgaacttg
gttcaaaataaccaactcgattattttaaatgggatatgaatcgccatcttacacaggtt
ggcagcacacgcttaccggctgcacaacagggggaactgtattatcgctacgtctgtgga
atttatgatattctcacacgcttgaagcgcgcctgccccaagctgattatcgaaaattgt
tcagctggtggtggccggtttgattttggtatgctaccatacaccaatcagacgtggata
agcgatttgactgatccagtcgaccgagcaaccatcgagaacggatttagttatctattt
ccaccacggatattcagcaaccatataaccgcatcacccaatgcgcaaaatggccgaata
acaccatttgaaactcgattacaattagcctgcatcgggcaactaggattggaacttaat
cctaaacaacttgctcctagtgaacagcaacttcttcgaggagccttgattaaatatcag
caactgaaatctacttttatcaaggcccacttttatcgtctaccgacaacaagacacgtt
gttgcgtggttgttagtaacggcagataaaaagcaggcaatttgctgttacttaaatggg
cttaattctgctgtcaaaactcagcacccattaccattacactatctcgatgctgaatta
acttatagcgattcatcaggtaatagctatacggggcatcagttaaacacgatgggaatt
ccacttaaacccaccaacgctgatttcactagtcagctaatttatttacgtcaaagttaa

DBGET integrated database retrieval system