KEGG   Lactobacillus plantarum ZJ316: zj316_0654Help
Entry
zj316_0654        CDS       T02458                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpt00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680781..682061
Genome map
AA seq 426 aa AA seqDB search
MKKMIIHGGKRLSGELTIGGAKNSTVALIPAAILADTPVQFDTVPHILDVHNLRLILESM
NVHSTFENDVLTIDPTNIEESELPSHAIKSLRASYYFMGALLGRFNRATVTFPGGDNIGP
RPIDQHIKGFKALGANVVEENDSVFISTGTEGLHGARIFLDVVSVGATINIILAAVKAHG
TTTIENAAKEPEIIDLATFLNNMGAKIRGAGTDVIRIEGVPALHSRATHTIIPDRIETGT
YLSLAASIGDGILLKNVIPEHMESFTAKLVEMGVDLQINEDSIYVPRSNDLDPIRVKTMT
YPGFATDLQQPITPLLLRANGSSVVIDTIYPQRTQHVEQLRKMGADIRVQDNLIVVGHSS
HLQGAHVEAGEIRSGAALMIAGLAASGVTEISRADNILRGYDRVIDKLHTLGADVEIAAD
EEVPEN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgataatccatggcggaaaacgactttctggggaattaacgatcggtggc
gcaaaaaatagtaccgtcgcactgattcctgctgcgattcttgcagacactccggtccaa
ttcgatacggttccgcacatcttagacgttcacaacttacggctcatcttagagtcgatg
aacgtccattccacttttgaaaatgatgttctaacaattgatccaacaaatattgaagaa
tctgaattaccaagtcatgccattaaaagcttgcgagcttcttactactttatgggggcc
ttactcggtcgttttaaccgtgcaacggtgactttccctggtggtgataatattggtcca
cgaccaattgatcagcatatcaagggttttaaggcgctcggcgctaacgtcgttgaagag
aatgactctgtctttatctcaacgggcacagagggccttcacggagcgcgcatcttttta
gacgtggtttccgttggggcgacgatcaacattattttggctgccgtcaaagctcatggt
acgaccacgattgaaaatgcggctaaagagcctgaaatcattgatttagcgacttttttg
aataatatgggcgctaaaattcggggtgctggtaccgacgtaattcgaatcgaaggcgtt
ccggcactgcattcgcgggcaacccatacgattattcctgatcggattgagacgggaacg
tatctatccctggctgcttcgattggggacggtattttgctaaagaatgtgatccctgaa
catatggagtcattcacggcaaaactagtcgaaatgggtgtcgatttacagattaatgaa
gatagtatttacgtcccacggtccaatgatttggacccaattcgggttaaaacaatgact
tacccaggctttgccactgatttgcaacaaccaatcaccccattattattgcgtgctaac
ggtagtagcgtggtgattgatacgatttatccgcaacgcacgcaacacgttgaacagtta
cgtaagatgggggcggacattcgcgttcaagataacttgattgtcgtgggtcattcttcc
cacttacaaggtgcacatgtcgaggccggtgagattcggtctggggcggcactaatgatt
gctggtctcgcggctagtggcgttacggaaattagtcgcgctgacaatattctacgtggc
tatgatcgggtcatcgataaattgcatacacttggtgcggatgtggaaattgcagccgac
gaagaagttcccgaaaactaa

DBGET integrated database retrieval system