KEGG   Lactobacillus plantarum ZJ316: zj316_0853Help
Entry
zj316_0853        CDS       T02458                                 

Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpt  Lactobacillus plantarum ZJ316
Brite
Enzymes [BR:lpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     zj316_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900455..901204
Genome map
AA seq 249 aa AA seqDB search
MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTVYGPQFSGHATDDPRD
ILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAALERDPQLLGGGTFSSPL
FAGNRSDVAEMFITLSHHQLAHSQFSIAEREQILMVLPELVQRQLQAVNTFTTTEVTSHL
SAVTQPFFIGQGGQDELIDATVARQLRDQLPQVPVDFHWYADAGHVITVNSAHHQLEQDV
LTYLKTIYK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaaacaaccggaaccgtttttctttgaacatggccaacatgccgtcatttta
ttgcacgcctatgcgggaagtgccaatgatgtgcggatgttagcacgagcattagaacgg
gaagattatacagtttatggcccccaattcagtggacacgcgactgatgatccgcgagat
attctcgcacagacgccggcgcaatggtggcaagatacgcaacaagcaatatcatttatg
cggcaaaaaggctatactaaaattagtatctttggcttatcattaggtggtatttttgcg
acggcggccttggagcgtgatcctcagttgttaggtggtggcacgtttagttcaccacta
tttgctggtaatcgtagtgacgttgctgaaatgtttatcacgctgagtcaccatcaactg
gcgcacagtcaattctcaattgccgagcgtgaacagatcttaatggtgttgccagaactg
gttcagcggcaactgcaggcagtcaatacctttaccacgacggaggttacgagtcacctc
agcgctgtgacccaacccttcttcattggtcagggtgggcaagatgaattaattgatgcg
acggtggcgcgacaattacgtgatcaattaccacaagtaccagttgattttcattggtat
gctgatgctggacacgtgattaccgtcaacagtgcgcatcaccaattggaacaagatgtt
ttaacatatttaaaaactatttataaatga

DBGET integrated database retrieval system