KEGG   Lactobacillus plantarum ZJ316: zj316_1652Help
Entry
zj316_1652        CDS       T02458                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpt01100  Metabolic pathways
lpt01110  Biosynthesis of secondary metabolites
lpt01130  Biosynthesis of antibiotics
lpt01230  Biosynthesis of amino acids
Module
lpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    zj316_1652 (trpC)
Enzymes [BR:lpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     zj316_1652 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh QRPTase_C DHO_dh PDZ
Motif
Other DBs
NCBI-ProteinID: AGE39191
UniProt: M4KL57
Position
1714613..1715395
Genome map
AA seq 260 aa AA seqDB search
MILDQLVQASQQRVQKVPVRERVKRIQQTRKMTTPVLSFEAMLAQPGLQLIGEVKRASPS
KGLIAAEFDYLQIAQDYVAAGIDAISVLTEPRYFKGQLSYLQAIAQTVSVPTLRKDFIVA
ASQIASARIAGASAVLLIVAILTPVQLQAFITLAHELNLSALVEVHTTAEIKQAVAAGAR
IIGINNRNLKDFSVNFATSCQLRQAVPAECYVVAESGIQTATQAQQLAAAGFDAMLVGET
LMRAPDKGQAVMQLRAGVRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatcaactcgtccaggcgagtcagcaacgggttcagaaggtgccagttagg
gagcgtgtgaagcgcattcaacaaactcgaaaaatgaccacccccgttttatcatttgaa
gcaatgctggcccagccgggcttacagcttattggtgaagttaagcgggcgtcaccttct
aaggggctgattgcggctgagtttgactatttacagattgcgcaagactatgttgctgct
gggatcgatgccatctcagtgttgaccgaaccccggtattttaaaggacagttgtcttac
ttacaagccattgcgcaaacggtctcggtacccacattacgtaaagattttattgtggct
gctagtcagattgcgagtgctcgtattgctggtgctagtgcggttttattgattgttgct
attttaacaccggttcaactgcaggctttcattacgttggctcatgagctgaatttaagt
gcgctagttgaagtccatacaacggctgagattaagcaagcggtggcggctggggcccgg
attattggcattaataatcggaatttgaaagatttcagtgtcaattttgcaacgagctgt
cagttacggcaagcagttccagctgagtgttatgtggtcgctgagtctggtattcaaacg
gccacacaggctcaacagttggccgctgctggctttgacgccatgctagttggcgaaaca
ttgatgcgtgcaccagataaaggtcaagccgtcatgcaattgcgggcgggggtgcgtgga
tga

DBGET integrated database retrieval system