KEGG   Lactobacillus plantarum ZJ316: zj316_2644Help
Entry
zj316_2644        CDS       T02458                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    zj316_2644 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    zj316_2644 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    zj316_2644 (thrC)
Enzymes [BR:lpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     zj316_2644 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2671682..2673175
Genome map
AA seq 497 aa AA seqDB search
MKTLYRSTRETASHTMTSSQAVLQGLTPDGGLFVPVTLPTANFDFDQLATMSYQEVAYEV
LKLFFTDYTADELHACIDAAYGDQFDDPQIAPVTKHGQQYYLELFHGPTIAFKDLALQIL
PHLMTTAVKKNHLQAEVVILAATSGDTGKAAMAGFANVDQTHIIVFYPKDGVSAIQKQQM
VTQTGANTSVVAINGNFDEAQTTVKKLLNDHQLHAELATHQFQCSSANSINIGRLFPQVA
YYVYTYAQLIKQGQIKNGDEINFSVPTGNFGDILAGYYAKQLGTPIHKLICASNRNNVLT
DFFNTGTYDKNREFFLTSSPSMDILVSSNLERLLFYLTGSDATATAKLMTDLQTTGRYTI
TPAMRANLADFWAGFVTESQDQAEIHHLNHAHHYTIDPHTAVASAVAKQYQAATRDQRPM
VVVSTASPYKFPQAVLTAITGELSAVDGLAAVDQLHELIQTPIPATVTALRTAPVRHKRV
ADVDDMGTTIKTILNLN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactttatcgcagtacccgcgaaactgcaagtcacaccatgacgtcatcacaa
gccgtacttcaaggcctgacgccggatggtggtctctttgtgcccgtaacgctaccgacc
gctaattttgacttcgaccagctcgccacgatgagctaccaagaagttgcttacgaggtc
cttaaactcttcttcacggattataccgctgatgaattacacgcctgcattgacgcggct
tatggtgatcagtttgatgacccccaaattgcgccggtcaccaagcatggtcagcagtat
taccttgaactttttcatggaccgaccattgcattcaaagacttggcccttcaaatccta
ccgcatttgatgacaacggcagttaaaaagaaccatttacaagccgaagtcgttatttta
gcggccacctcgggcgatactggtaaagctgccatggccgggtttgccaatgttgatcag
actcacatcatcgtcttctacccaaaagatggtgtcagcgcaatccaaaaacagcagatg
gtgacccaaaccggagccaatactagtgttgttgcgatcaacggtaacttcgatgaggcc
caaacaacggttaaaaaactgttaaacgaccaccaattacacgcggaattagccacccac
cagttccaatgctcaagcgctaattccatcaatattggtcgtttattcccacaagtggcc
tattatgtctacacctacgctcaacttatcaagcaggggcaaatcaagaacggtgatgag
attaactttagtgttccaactgggaactttggggatattttagctggctactatgccaaa
caactgggcacgcccattcataaactgatctgtgcttccaatcgcaataacgttctcacc
gatttctttaataccgggacttatgataaaaaccgtgaattcttcttgacgagttcaccg
tccatggacatcttagtctcaagtaacctggaacggctcctcttctacttgacaggatca
gacgccacggcgactgctaaactaatgactgatttgcaaacgaccggccgttatacgatt
acaccggcaatgcgtgccaacttagctgatttttgggccggcttcgttactgaaagccaa
gatcaagctgaaattcatcacctgaaccatgcccatcactacacaatcgatccacatacg
gccgtggcctcggcggttgccaaacagtatcaagccgcaaccagagatcagcggcccatg
gtggttgtttcaaccgctagtccgtataaattcccacaggccgtcctaacggcaattact
ggtgagcttagtgcggtagatggcctagccgcagttgatcagttacatgagttgattcaa
acgcccattccagcaacggtcacagccctccgtactgcgcccgtgcgccataagcgggtt
gcggatgttgatgatatgggaacgaccattaaaacaattttaaatcttaactag

DBGET integrated database retrieval system