KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: LPE509_00183Help
Entry
LPE509_00183      CDS       T02511                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpu  Legionella pneumophila subsp. pneumophila Philadelphia 1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(176948..177751)
Genome map
AA seq 267 aa AA seqDB search
MKNEYSMKINDFRYMRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAVYR
YLIPNLKNYDAILCPVLAGHAESIEAFSKSKAADWLQSAKSACELLINQYQKVDVLGLSL
GGLLACQLSQSYAINHLFLLAPALKLHMRINAMLKLAQILKCLGFRQLRNAAGNIITDEH
AEIAYRKLPISTIIEMLTLAQGYEWLPPTCPADLFLGIHDQVVASQQVEQLFCNLPNVKI
HWLKNSAHVLPLDNDLNEIIDCINKSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaatattctatgaaaatcaatgattttcggtatatgcgccgcggcaaacat
ctcagcgaactgcagtcggaggaagcaaatctccttgctccagtcaatcagcgtggtaaa
ggcacagaacgagctttactggtattgcatggtttctcttcttcaccggcagtttaccga
tatctgattcctaatttaaaaaattatgatgccatcctttgtcctgtattggctggtcac
gccgaaagtatagaagccttttcaaaatccaaagcagctgattggcttcaatcagcaaaa
agcgcctgtgaactcttaataaatcagtatcaaaaagttgatgttttaggattatccctg
ggaggattattagcctgtcaattaagtcaatcctatgctatcaatcacctgtttctatta
gcccccgcattaaaattacacatgcgcatcaacgccatgctgaaattagcccagattctt
aagtgcctcggatttcgacaacttcgcaacgctgcagggaatattatcaccgatgagcat
gccgaaatcgcttatagaaaacttcccatttccacaatcattgaaatgctaaccttggct
cagggatatgaatggctccccccaacttgcccggccgatctttttcttggaattcatgat
caagtggttgcttctcaacaagtagaacaattattttgtaatttacctaatgtcaaaata
cattggctaaaaaattccgcgcatgtactgccgctagacaacgatctgaatgagattatt
gattgtattaataaaagcaaatga

DBGET integrated database retrieval system