KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: LPE509_00263Help
Entry
LPE509_00263      CDS       T02511                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lpu  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(281350..281889)
Genome map
AA seq 179 aa AA seqDB search
MEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGALFDSDMSEMV
IVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQIQERLTGEIA
HCIESTTGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCRLEFLNLIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatactcaaatttgcttaaagaattaggcgaagatataaatcgggaagga
ttaaaggatactcctggacgagcagctaatgccttacgttatttaactaaaggttacaat
gagaaccttgatgaaatcattaacggtgctctgtttgattcagacatgagtgaaatggtt
atcgtcaaggacatagaactgtactcattatgcgaacatcacttattgccttttttgggt
aaatgccatgttggatatctacctgatggtaaagtaataggcttatctaaaattgctcgt
attgttgatttttatgcgaggagactacaaattcaagaacggctgacgggcgaaattgct
cactgtattgaatccactaccggagctcgcggtgtcgccgtagtgattgaagcaaaacat
ctttgcatgatgatgcgtggagttgaaaaacaaaattctgtcatgacaacttcagttatg
ctcggtgaaatgcgtaacaattcgagctgccgtttggaattcttaaatttaattcgttaa

DBGET integrated database retrieval system