KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_01589Help
Entry
LPE509_01589      CDS       T02511                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
lpu00330  Arginine and proline metabolism
lpu00332  Carbapenem biosynthesis
lpu01100  Metabolic pathways
lpu01130  Biosynthesis of antibiotics
lpu01230  Biosynthesis of amino acids
Module
lpu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPE509_01589
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LPE509_01589
Enzymes [BR:lpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LPE509_01589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGH53680
Position
1694217..1695287
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSSLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNVESIVP
KILNREAVGTIILASKRKSSIKRWIAFSHRTSLPSIVINDNLITLLRNGNRVMSILPIGI
EDFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDQLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatcggtcgacggaagtccaatc
tattccgtactcaataatcttgtaaatcaaattatttatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgtgggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggcgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagcttgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaaacaagacttccatactagacagcattatttaaatattgcccgtttatta
acagaattgctaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttaccgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatctcatcccaat
gatcctgaatcaaaactcattaatacaattgaccccaattcaggttggcccaatgtctct
gctgtaaaatcaaaattaggccgaggtggtatggtatccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgtagaatccattgttcca
aaaattctaaatagggaagcagttggaaccataattcttgctagtaaaagaaaatccagt
ataaagagatggattgcttttagtcatagaacttccttaccatctatagtaattaatgat
aatttaattaccttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaagattttcgtggagaatgcaaaaaaggggatttaattgatatccttaattccaacaat
gaaaagataggagttggaatcgccaggtatgatttcttaagattaaaggactatcttaga
cttcaaaataagcctgcatttatacattacgatcaattgcatattctatag

DBGET integrated database retrieval system