KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_01599Help
Entry
LPE509_01599      CDS       T02511                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
lpu00071  Fatty acid degradation
lpu00072  Synthesis and degradation of ketone bodies
lpu00280  Valine, leucine and isoleucine degradation
lpu00310  Lysine degradation
lpu00362  Benzoate degradation
lpu00380  Tryptophan metabolism
lpu00620  Pyruvate metabolism
lpu00630  Glyoxylate and dicarboxylate metabolism
lpu00640  Propanoate metabolism
lpu00650  Butanoate metabolism
lpu00900  Terpenoid backbone biosynthesis
lpu01100  Metabolic pathways
lpu01110  Biosynthesis of secondary metabolites
lpu01120  Microbial metabolism in diverse environments
lpu01130  Biosynthesis of antibiotics
lpu01200  Carbon metabolism
lpu01212  Fatty acid metabolism
lpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPE509_01599
   00630 Glyoxylate and dicarboxylate metabolism
    LPE509_01599
   00640 Propanoate metabolism
    LPE509_01599
   00650 Butanoate metabolism
    LPE509_01599
  Lipid metabolism
   00071 Fatty acid degradation
    LPE509_01599
   00072 Synthesis and degradation of ketone bodies
    LPE509_01599
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPE509_01599
   00310 Lysine degradation
    LPE509_01599
   00380 Tryptophan metabolism
    LPE509_01599
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPE509_01599
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPE509_01599
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPE509_01599
Enzymes [BR:lpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPE509_01599
Exosome [BR:lpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPE509_01599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGH53690
Position
1706591..1707910
Genome map
AA seq 439 aa AA seqDB search
MKHQSNLSGRNVYVVDGSRTPFLKAKGVGPFCGSDLAVAAGTTLLNRQPFSPDELDEVII
GSAMPGPDEANIARVVALRLGCGDKVPAFTVMRNCASGMQALDNAAIQIATGRSNLVLAG
GTDAMSHAPLLFNEKMASWLANWFAAKSMGQKLALITKFKPSYLAPVIALLRGLTDPIVG
LNMGQTAEKVAYRFNITREQMDEFAAQSHLRIAQAYAENRMSEVAPIIDYKGCIYPQDDG
IRADSTVEKLSKLKPFFDKKYGMVTPGNSSQITDGACMLLLASAEAVKKYALPVLGRIVD
SQWAALDPSQMGLGPVHAATPILERHNLKPQDLDCWEINEAFAAQVLGCLAAWNDEEYCK
TQLGLKEAIGAPSLERLNRDGGAIALGHPIGASGARIVLHVLKSLEQRNESRGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagtcgaatttaagtggtcgtaacgtttatgttgtcgatggaagtcgaacg
ccttttcttaaagcaaaaggagtaggtccattctgtggttcagatttggcagttgctgca
ggaacaactttgctaaatcgtcaaccattttctccggacgagcttgatgaggtcattatt
ggtagcgctatgcctggaccagacgaggccaatatcgctcgcgtggttgctctgcgtttg
ggatgtggtgataaggtgcctgcatttactgtaatgagaaattgtgcgtcaggcatgcag
gcattggataatgccgcaatccaaattgctacagggcgcagtaatttggtccttgctggt
ggaacagatgccatgagtcatgcaccgttgttatttaatgaaaaaatggcttcctggctt
gcaaactggtttgcagctaaaagtatggggcaaaagctggctttaattacaaagtttaaa
ccttcttatctggcaccggtaatcgctttgctcagaggcctgactgatcctatagtagga
ttgaatatgggacaaacagctgaaaaagtagcttatcgatttaacatcacaagagagcaa
atggatgaattcgcagctcaaagccatttaagaatagctcaagcttatgctgaaaataga
atgtctgaagttgccccaattatagattataaaggttgtatatatcctcaagatgatggg
attagggcagattccacagtggaaaaattgtcaaaactaaaacctttttttgacaaaaaa
tatggcatggtcaccccaggcaacagttcacagataactgatggtgcctgtatgttgcta
ttggccagcgctgaggctgtaaaaaaatatgctttaccggtattaggtcgaatagttgat
tcacaatgggctgctctagatccctctcaaatgggtttgggtcctgttcacgcggcaacc
cctatattagaaagacataatttaaagccacaagatttggattgttgggaaatcaatgag
gcctttgccgctcaagtcttagggtgtttggctgcatggaacgatgaagaatactgcaaa
acacagcttggccttaaggaggcaattggagcgccatcgctggagcgactcaatcgggat
ggaggagcaattgcgttaggtcatcctattggtgccagtggggctcgtattgtattgcac
gttcttaaatctttagagcaaagaaatgagtcgcgaggtatggcagcaatttgtatcgga
ggtggtcagggaggagctatgtatcttgaacgagttactgaggtgaaaggacatgaataa

DBGET integrated database retrieval system