KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_01599Help
Entry
LPE509_01599      CDS       T02511                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPE509_01599
   00630 Glyoxylate and dicarboxylate metabolism
    LPE509_01599
   00640 Propanoate metabolism
    LPE509_01599
   00650 Butanoate metabolism
    LPE509_01599
  Lipid metabolism
   00071 Fatty acid degradation
    LPE509_01599
   00072 Synthesis and degradation of ketone bodies
    LPE509_01599
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPE509_01599
   00310 Lysine degradation
    LPE509_01599
   00380 Tryptophan metabolism
    LPE509_01599
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPE509_01599
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPE509_01599
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LPE509_01599
Enzymes [BR:lpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPE509_01599
Exosome [BR:lpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPE509_01599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1706591..1707910
Genome map
AA seq 439 aa AA seqDB search
MKHQSNLSGRNVYVVDGSRTPFLKAKGVGPFCGSDLAVAAGTTLLNRQPFSPDELDEVII
GSAMPGPDEANIARVVALRLGCGDKVPAFTVMRNCASGMQALDNAAIQIATGRSNLVLAG
GTDAMSHAPLLFNEKMASWLANWFAAKSMGQKLALITKFKPSYLAPVIALLRGLTDPIVG
LNMGQTAEKVAYRFNITREQMDEFAAQSHLRIAQAYAENRMSEVAPIIDYKGCIYPQDDG
IRADSTVEKLSKLKPFFDKKYGMVTPGNSSQITDGACMLLLASAEAVKKYALPVLGRIVD
SQWAALDPSQMGLGPVHAATPILERHNLKPQDLDCWEINEAFAAQVLGCLAAWNDEEYCK
TQLGLKEAIGAPSLERLNRDGGAIALGHPIGASGARIVLHVLKSLEQRNESRGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagtcgaatttaagtggtcgtaacgtttatgttgtcgatggaagtcgaacg
ccttttcttaaagcaaaaggagtaggtccattctgtggttcagatttggcagttgctgca
ggaacaactttgctaaatcgtcaaccattttctccggacgagcttgatgaggtcattatt
ggtagcgctatgcctggaccagacgaggccaatatcgctcgcgtggttgctctgcgtttg
ggatgtggtgataaggtgcctgcatttactgtaatgagaaattgtgcgtcaggcatgcag
gcattggataatgccgcaatccaaattgctacagggcgcagtaatttggtccttgctggt
ggaacagatgccatgagtcatgcaccgttgttatttaatgaaaaaatggcttcctggctt
gcaaactggtttgcagctaaaagtatggggcaaaagctggctttaattacaaagtttaaa
ccttcttatctggcaccggtaatcgctttgctcagaggcctgactgatcctatagtagga
ttgaatatgggacaaacagctgaaaaagtagcttatcgatttaacatcacaagagagcaa
atggatgaattcgcagctcaaagccatttaagaatagctcaagcttatgctgaaaataga
atgtctgaagttgccccaattatagattataaaggttgtatatatcctcaagatgatggg
attagggcagattccacagtggaaaaattgtcaaaactaaaacctttttttgacaaaaaa
tatggcatggtcaccccaggcaacagttcacagataactgatggtgcctgtatgttgcta
ttggccagcgctgaggctgtaaaaaaatatgctttaccggtattaggtcgaatagttgat
tcacaatgggctgctctagatccctctcaaatgggtttgggtcctgttcacgcggcaacc
cctatattagaaagacataatttaaagccacaagatttggattgttgggaaatcaatgag
gcctttgccgctcaagtcttagggtgtttggctgcatggaacgatgaagaatactgcaaa
acacagcttggccttaaggaggcaattggagcgccatcgctggagcgactcaatcgggat
ggaggagcaattgcgttaggtcatcctattggtgccagtggggctcgtattgtattgcac
gttcttaaatctttagagcaaagaaatgagtcgcgaggtatggcagcaatttgtatcgga
ggtggtcagggaggagctatgtatcttgaacgagttactgaggtgaaaggacatgaataa

DBGET integrated database retrieval system