KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_01967Help
Entry
LPE509_01967      CDS       T02511                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LPE509_01967
  Amino acid metabolism
   00340 Histidine metabolism
    LPE509_01967
Enzymes [BR:lpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LPE509_01967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2098340..2099635
Genome map
AA seq 431 aa AA seqDB search
MLTIKNWQLLSENDKRRCLSRPRDNSAIKENVLEIINQVQLSGDKALYDLTKRFDRVNLQ
YLQISQEKIRQASIPQNALIAIKQAIETISSYHQSLLPENTEISTASGITIRNVYRPIQK
VGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLCTPPDAEGEINEHILVAARLCGIDTI
YAIGGAQAIAAMAYGTESVIKVDKIFGPGNSYVTQAKTLVAIDADGAAIDMPAGPSEVMI
IADTEANPEFIAADLLAQAEHGPDSQVILICDECELANQVNQQLEIQMRYLSRIEFIKQS
LANSRIIICSNQSEQLDIINSYAPEHLIINRKNPEPWVEKIVAAGTVFLGSWAAETMGDY
VTGSNHVLPTSGFARNHSGLSTLDFMTRFTVQAINQEAIRNLGPAAMTLAELEGLDAHAN
AVQIRLNTLGD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgataaaaaactggcaattactgtctgagaacgataaaaggcgatgcctttca
aggccacgagacaattctgcaataaaggaaaatgtgctggaaattataaatcaggtccaa
ttatcaggagataaagcactttacgatttaaccaaacggtttgatagagtcaatttacaa
tatttacagatctcacaggaaaaaattagacaagccagcataccgcaaaatgccttaatc
gccataaaacaagccattgaaacaatctcgtcatatcaccagtctttgttgcctgaaaat
accgagatttcgactgcatcaggaattacaatccgcaatgtctacagaccaatccaaaaa
gttggcttgtatgtgcctggaggaaataaaacacctttagtttcttcgcttctcatgcaa
gcaattccggcaaaggtagcgggctgcccaataaaagtgctttgtactccccctgatgca
gaaggggaaattaacgagcatatcctggtagctgcaagattatgtggcatcgacacaatt
tacgctataggtggagctcaagccatagcggctatggcttatggcactgaaagtgtcatc
aaagtggataaaatattcgggccgggtaatagctatgtcactcaggcaaaaactttagtt
gcaattgacgccgacggagctgcgattgacatgcccgctgggccatctgaagtgatgatt
attgcagatactgaggcaaaccctgaatttattgctgcagatttattagcccaggctgaa
catggcccggattcacaggttattttaatttgtgatgaatgtgaattggcaaaccaggtt
aatcaacagctggaaattcagatgagatatttgtcaagaatagaatttatcaaacaatct
ctcgcgaatagcaggataattatctgttctaatcaatcggaacagctggatattatcaac
tcctacgctccggaacacctgatcattaacagaaaaaaccccgaaccatgggttgagaaa
atcgtggctgccggaacagtatttcttggctcttgggccgcagaaacaatgggtgattat
gtaacaggaagcaatcacgtcttacctaccagtggttttgccagaaaccatagcgggctt
tctactcttgattttatgacacgatttaccgtgcaagccataaatcaagaggctatccgt
aatttaggtccagcggcaatgactttagcggaattagagggtttggatgctcatgccaat
gccgttcaaataagactcaatactctgggggattaa

DBGET integrated database retrieval system