KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: LPE509_02168Help
Entry
LPE509_02168      CDS       T02511                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lpu  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpu00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2307613..2309127)
Genome map
AA seq 504 aa AA seqDB search
MSKKTPHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVTLGSRSIIATLNVV
TSELLQPGEAGLSDYAWESLHAKEGDEIQVSHPKPLESLSYVHAKIYGNELSFEQMKVII
DDVLSGRLSDVQISAFLAASGAGRLTRTEVMKLTKAMIDSGDRLSWPSPLVVDKHCVGGL
PGNRTTLIVVPIVASFGLMIPKTSSRAITSPAGTADTMETLAPVHLSPQKMRQVVEQENG
CIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATHAVIDIPVGPTAKV
RNQSMALLLKQSLEEVGNELGLVVRALFTDGSQPVGHGIGPSLEARDVLAVLQGLPDAPN
DLRERALTLAGAALECSSKVPPGLGKSIATQLLESGQAFKKFQAICEAQGGMRELTKARF
TYPVVAAKEGKVSLIDNRKLAKIAKLAGAPKSKSAGIDLHAHVGESVEQGEPLFTIHSES
LGELHYACDLLRDKQDIIILGENP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagaaaacccctcatgggcttcgtttaaagcatttagggattaaaacctatcat
gaagccattatttacatgcgcgaggattgccatgtctgtcactcggaaggatttgaagta
cagacccgtatccaagtgactttaggtagccgctccattatagccaccctcaatgtggtg
acctcagagctacttcagcctggtgaggctggtttgtcggattacgcctgggagtcttta
catgccaaagaaggtgatgaaattcaggtctctcatccaaaacccttggaatccttaagc
tatgtgcatgccaagatttatggcaatgaactgtcttttgagcaaatgaaagtgattatt
gatgatgtgttaagcggtcgactttctgatgtacaaatttccgcttttctagcggcaagt
ggcgcaggacgtctaacccgtacggaagtgatgaagctcaccaaagctatgattgatagt
ggcgatcgtttatcttggccttcgcctctggtcgttgataaacattgcgtggggggatta
ccgggaaatcgcacgactctgattgtagttcccattgtggcttcatttggattgatgatt
ccaaaaacatcatcgcgtgctattacatcccctgcgggaactgcagataccatggagact
ttagctccagtccacttaagtccccaaaagatgcgccaagtggttgaacaagaaaatggc
tgtattgtctggggtggggctgtgagtttaagtcctgctgatgacgtgcttattcgtgtg
gaacgagccatagatttagatagtgaagggcaattagtggcttccattctttctaaaaaa
attgcaacaggggccacacacgcggttattgatatccccgtaggacctactgccaaagtc
aggaatcagtctatggcgctccttctgaaacaatcacttgaggaggtaggtaacgagtta
gggcttgttgtccgtgcgttatttacggatgggtcgcagccggtaggccatggcattggt
ccatcgttagaagctcgcgatgtattggcagtattacaagggttgcctgatgcgcccaat
gatttgcgtgaacgagcgttgacgcttgcaggtgctgcgttagagtgttcttcgaaagta
ccaccgggtttaggtaaatccattgcgacgcaattattggagagtgggcaagcgtttaag
aaatttcaggccatttgtgaggctcagggtgggatgagggaattgaccaaggcacgtttt
acttatcctgttgtggctgcaaaggaaggaaaagtctccctcattgacaatcgaaagctt
gcaaaaatagctaagcttgctggtgcgccaaaatcgaaatcggcgggtattgacctccat
gcccatgtcggcgaatccgttgaacaaggcgagcctttgtttacaattcattcggagtct
ttaggggagctccattacgcctgtgatttacttcgcgataaacaagacatcattatttta
ggagaaaacccttga

DBGET integrated database retrieval system