KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_02581Help
Entry
LPE509_02581      CDS       T02511                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPE509_02581
Enzymes [BR:lpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPE509_02581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2754690..2755319)
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQYGTICSRIGLSEQAY
AFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTD
FRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQAVVEGEQVLIGGNESYV
ATCRLHYKLGEAGKTFPRNKLFNKDTNTF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatatttctactatgcggctatgaatgcaggtaaaagtacggtgttactg
cagtccagttataattacagagaacgcggtatgcaaactctgttgtttaccccagccatc
gatacacgtttccaatatggaactatctgttcacgtatcggtttatccgaacaggcttat
gcttttaacaattcggataacctgtatgttttaactcaagaatttcaactacaaactcag
aaatactcttgtgtcctgattgacgaggctcaatttttaactcgagagcaagtgtatcaa
ttaacggaaataaccgatcaaatgtctattccagtactagcttatgggttacgcactgac
tttagaggcgagttatttccgggaagtcaatttttactggcttgggcagatgagttaatc
gaattaaagacaatttgtcattgtggccgtaaagcaattatgaatatgagaattgatgaa
aatgggcaagctgttgttgagggggagcaggtattgataggcggcaatgaatcctatgtt
gctacctgtcggttgcattataaattaggtgaagcagggaagacgtttccaagaaataaa
ttgttcaataaagataccaatactttttaa

DBGET integrated database retrieval system