KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: LPE509_02659Help
Entry
LPE509_02659      CDS       T02511                                 

Definition
Fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpu  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lpu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lpu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2832051..2833058)
Genome map
AA seq 335 aa AA seqDB search
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKYEKNTGIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgaa
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacgcca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggcatcggccattattggggatac
aggaattttgaatgtcctgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcgtcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttccttgttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgttttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagtatgaaaaaaataccggcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgctcaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system