KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_02659Help
Entry
LPE509_02659      CDS       T02511                                 

Definition
Fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LPE509_02659
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LPE509_02659
Enzymes [BR:lpu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LPE509_02659
Lipid biosynthesis proteins [BR:lpu01004]
 Desaturase
  First
   LPE509_02659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2832051..2833058)
Genome map
AA seq 335 aa AA seqDB search
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKYEKNTGIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgaa
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacgcca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggcatcggccattattggggatac
aggaattttgaatgtcctgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcgtcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttccttgttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgttttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagtatgaaaaaaataccggcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgctcaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system