KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: LPE509_02661Help
Entry
LPE509_02661      CDS       T02511                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpu  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lpu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2833649..2834473
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELCQGKHITAITRRGKYI
LLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHVDLHINNGLALRFCDPRRFGLFIYIDE
NPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFL
AKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYG
RKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagtcgaaacaacaaagcaaggtattaaaccccatcttgaaggc
cgtatgattaccgcagtgcaagtgcgtaatcgaaaacttagattaccagtacctctaaac
ctgaatgaattatgccaaggaaagcatataacagctattacccgtagaggaaaatacatc
ttacttcatatggataaaggttatcttctcatccatcttggaatgtccggacatttgcgt
atcgtatcccagacagcaaatcctcaaaaacatgatcatgttgatctgcacattaataat
gggcttgctctcagattctgcgatcctagaagatttggcttatttatttacattgatgaa
aatccttaccaacacccactgctggcacatttaggcccggaacctctgtctgatgacttt
aatagcgagtacttattacgtaaagctgcgaataaatcgcaatccatcaagtcatttatt
atggatagtcaaattgttgtcgggatagggaatatttatgcggcagagagtctttttctt
gccaaaatccatccaaatacctctgcaaaaaagataactacagaagaattcaattctctg
actggtcacatcaaaaagatacttgaatctgccatagaggctggagggacgacacttcgt
gatttctattcttctgatggtaaaccagggtactttcgttttgctttaaaggtttatggc
aggaaaaatctcccctgtttggtatgtgaaaataaaatagaaactgtcgtgattgccggg
cgccactccgcattttgcccacattgccagccaatcattacataa

DBGET integrated database retrieval system