KEGG   Lactobacillus plantarum 16: Lp16_0014Help
Entry
Lp16_0014         CDS       T02698                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lpz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16596..17393
Genome map
AA seq 265 aa AA seqDB search
MKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISAMRHRGREVVLVSSGAIGV
GLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQKIGQLLLTRDIFVYPKSHH
NVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQLSAIVATNIGADLLIMLSDI
DGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFGTGGMVTKLKAAERMIDANGQM
ILANGADPTIIFQILAGEPVGTLFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgatacgaaaactaaaggctaaacgagtcgtgattaaagtcgggacaagcacg
ctagtttatccagatggatcgatcaacttacgggcaatcgatcaattagcctttgttatt
agcgcaatgcgacaccgtgggcgtgaagttgtcttggtttcgtcaggggctattggtgtt
ggcttgaattatatgggactcaagcaacgtccaaaagcaattcctgaacaacaggcgatt
gcggcgattgggcaaactgaattgatttcgatttacaaagaacgtttcgccatttatgaa
caaaaaattggccagttgttattaacacgtgatatctttgtttatcctaagagtcaccat
aatgtgttgaatacatttgaggcgctattaaaacaaaacgtggtcccaattgttaatgaa
aatgatacggtcgcggtcgatgaattggatcatgaaacaaagttcggtgataacgatcaa
ctatccgcaatcgtggccacgaatatcggggcggatttgttaatcatgctatccgacatc
gatggcttttatgatggtaatcccaatgcggatgcccgagcccagttattagggcacatt
gagaaggttgatcaacatacttataagctagctggcggtagtggcagtcggtttggtact
ggtgggatggtcactaagctaaaagcggcagaacggatgatcgatgcgaatggtcaaatg
attttagccaatggtgcggatcccacaattatttttcaaattttagcaggcgaaccagtc
ggaacgctattcggttaa

DBGET integrated database retrieval system