KEGG   Lactobacillus plantarum 16: Lp16_0018Help
Entry
Lp16_0018         CDS       T02698                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lpz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21059..22963
Genome map
AA seq 634 aa AA seqDB search
MVKQTTEMNDASYLFNTGAGFNSQDYLGCHLGASGRAVFRVWAPHAKAVGVVGDFNDWQP
SALKLLGATGIWQGQVPNVHAGQLYKFQITTPTGQVQLKIDPFAQQFERKPGDAAVVVEP
MTMRWHDSLWLARRKKSRAANRPINIYEVHLGSWRRHLDGSYYTYAELAAELIPYVKQRG
YTHIELMPVMEHLLDASWGYQQLGYFAPTSRFGKRDSFLSFVDQCHQANIGVFVDWVPGH
FIRNYDALYQYDGTPTFEYADPERANNRRWGAWNFDLGKTQVQSFLISSAEYWLDQCHLD
GLRVDAVSNMLYCDYDEGREGQVNQYGDNRNLEGIAFLQKLNTTVLTHHPDILMIAEESS
AYPQVTGSVANGGLGFNYKWNMGWMHDTLDFFMMDPLYRHDHFNLLTFAFVYMFDERFIL
PFLHDEVVHGKKSLMHKMPGDRYNQFANLRTMLTYMAAFPGKQLNFMGSEWGQFLEWRDW
SALEWVDLKDDLNHRMQQFTTQLNAVYRHNRPLWEQDDDPAGIIYTHTDDPDSSTMGFIR
QAKRKYSFVVVAFNFVPVERQDYRIGVPYRGRYELLLNTEAQAFGGTWTKLETTFTAVDK
PYRGQPASFTVTLPAMGALLIRPVKVIGGVKHAR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttggttaaacaaactacggaaatgaatgatgcaagttacttatttaataccggcgcagga
tttaatagtcaggattacttaggctgtcatttgggcgcatctggtcgggcggtatttcgc
gtctgggcgccgcatgctaaggctgtcggggttgttggcgattttaatgactggcaacca
agcgcactaaagttattaggggcgacggggatttggcaaggacaagttccgaacgttcat
gcgggtcagttatacaagtttcagatcacaacaccaactggccaagtgcaactaaagatt
gacccgtttgcacaacagttcgaacgaaaaccgggggatgcggccgtagttgttgagccg
atgacgatgcgttggcacgatagtttgtggctagctcgccggaagaagtcgcgcgctgcc
aatcggccaattaacatttatgaggtgcacttaggttcgtggcgccgtcatcttgatggt
agctactacacttatgcggaattagccgctgaactgattccctatgtaaaacaacggggc
tatacccacattgaattaatgcccgtgatggaacatttgttagatgcgtcttggggttat
cagcaattagggtattttgcgccaaccagtcgttttggcaagcgtgacagttttctcagc
tttgttgaccagtgtcaccaagcgaatatcggggtattcgttgattgggtaccgggtcac
tttattcgcaattatgatgcgttgtaccagtatgatggtacgccgacatttgaatacgct
gatcctgagcgcgcgaataaccgtcgttggggggcatggaattttgatctcggtaaaaca
caggttcagagttttctgatttcaagcgccgaatattggctcgaccagtgtcatctagat
ggcttgcgagtggatgctgtctctaacatgttgtattgcgactatgatgaagggcgcgaa
gggcaggttaatcagtatggggataatcgtaatttagaaggcatcgcctttttacaaaag
ttgaacaccacggtcttaacccaccatcccgatatcttgatgattgcggaagagtcgtcc
gcctatccgcaggttacgggttcggtggccaatggcggattgggatttaactataagtgg
aacatggggtggatgcacgataccctggatttcttcatgatggatccgttatatcggcac
gaccactttaatctactgacatttgcattcgtgtacatgttcgatgaacggtttattcta
ccgtttttacatgatgaagtcgtgcacggcaagaaatcattaatgcataaaatgccgggg
gaccgctataatcagtttgcaaatttgcggacgatgctaacttatatggctgccttccca
ggaaaacaactgaattttatgggctcagagtgggggcagttcctagagtggcgggactgg
agtgcgttggaatgggtcgacttaaaggatgatctcaaccatcggatgcaacagttcaca
acgcaactgaacgcggtctatcggcacaatcggccgttgtgggagcaggacgatgatcct
gcggggattatttatacacataccgatgatcctgacagttcgaccatggggtttatccgg
caggccaaacggaaatacagttttgtggtcgttgctttcaattttgttcctgttgaacgt
caagattaccgtatcggcgtaccgtatcgtggccgttatgagttgttactcaacactgaa
gcgcaggcttttggcggcacgtggacaaagctagaaacaacgtttacggcggtcgataag
ccgtatcgggggcaaccagctagttttaccgtgaccttgccggcgatgggtgcattgttg
attcgaccagttaaagtgatagggggagttaagcatgcaagatga

DBGET integrated database retrieval system