KEGG   Lactobacillus plantarum 16: Lp16_0631Help
Entry
Lp16_0631         CDS       T02698                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpz  Lactobacillus plantarum 16
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680198..680947
Genome map
AA seq 249 aa AA seqDB search
MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTVYGPQFSGHATDDPRD
ILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAALERDPQLLGGGTFSSPL
FAGNRSDVAEMFITLSHHQLAHSQFSIAEREQILMVLPELVQRQLQAVNTFTTTEVTSHL
SAVTQPFFIGQGGQDELIDATVARQLRDQLPQVPVDFHWYADAGHVITVNSAHHQLEQDV
LTYLKTIYK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaaacaaccggaaccgtttttctttgaacatggccaacatgccgtcatttta
ttgcacgcctatgcgggaagtgccaatgatgtgcggatgttagcacgagcattagaacgg
gaagattatacagtttatggcccccaattcagtggacacgcgactgatgatccgcgagat
attctcgcacagacgccggcgcaatggtggcaagatacgcaacaagcaatatcatttatg
cggcaaaaaggctatactaaaattagtatctttggcttatcattaggtggtatttttgcg
acggcggccttggagcgtgatcctcagttgttaggtggtggcacgtttagttcaccacta
tttgctggtaatcgtagtgacgttgctgaaatgtttatcacgctgagtcaccatcaactg
gcgcacagtcaattctcaattgccgagcgtgaacagatcttaatggtgttgccagaactg
gttcagcggcaactgcaggcagtcaatacctttaccacgacggaggttacgagtcacctc
agcgctgtgacccaacccttcttcattggtcagggtgggcaagatgaattaattgatgcg
acggtggcgcgacaattacgtgatcaattaccacaagtaccagttgattttcattggtat
gctgatgctggacacgtgattaccgtcaacagtgcgcatcaccaattggaacaagatgtt
ttaacatatttaaaaactatttataaatga

DBGET integrated database retrieval system