KEGG   Lactobacillus plantarum 16: Lp16_0940Help
Entry
Lp16_0940         CDS       T02698                                 

Definition
glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Lp16_0940
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lp16_0940
   00330 Arginine and proline metabolism
    Lp16_0940
Enzymes [BR:lpz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     Lp16_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1018407..1019753)
Genome map
AA seq 448 aa AA seqDB search
MSQATDYVQHVYQVIEHRDPNQTEFLEAINDVFKTITPVLEQHPEYIEANILERLTEPER
IIQFRVPWLDDAGHARVNRGFRVQFNSAIGPYKGGLRLHPSVNLSIVKFLGFEQIFKNAL
TGLPIGGGKGGSDFDPKGKSDNEIMRFCQSFMTELSKYIGLDTDVPAGDIGVGGREIGFL
YGQYKRLRGADRGVLTGKGLNYGGSLARTEATGYGLAYYTNEMLKANQLSFPGQRVAISG
AGNVAIYAIQKVEALGGKVITCSDSNGYVIDENGIDFKIVKQIKEVERGRIKDYADRVAS
ASYYEGSVWDAQVAYDIALPCATQNEISGDQAKNLIANGAKVVAEGANMPSSPEAIAAYQ
ASSLLYGPAKAANAGGVAVSALEMSQNSMRLSWTFEEVDNRLKQIMQDIFAHSVAAADEY
HVSGDYLSGANIAGFTKVADAMLAQGLV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaagcaactgattatgtccaacacgtttaccaagtcattgaacaccgtgatccg
aaccaaaccgaatttttagaggccatcaacgacgtcttcaaaacgatcacgccagtcctc
gaacaacatccagaatatatcgaagccaatattttggaacgtttgaccgaaccagaacgg
attattcaattccgggttccttggctcgacgatgctggtcatgcacgagtcaaccgtggg
ttccgagtacaatttaactcagcaatcggtccatacaagggcggcttacggttacaccca
tccgttaatctgagtatcgtcaaattcttgggctttgaacagatcttcaaaaatgccctg
accggcctgccaatcggcggtggtaaagggggctctgatttcgaccctaagggcaaatca
gacaacgaaattatgcgcttctgtcagagtttcatgaccgaactgagcaagtacattggt
ctcgataccgacgttcctgctggtgatatcggtgttggtggccgcgaaattggcttttta
tacggccaatacaagcgactccggggcgctgaccgcggcgtactcaccggtaaaggtttg
aactatggcggttcgttagcccggactgaagctaccggttatggtctcgcctactatacc
aacgaaatgctcaaggccaaccaactttccttccctggtcaacgcgttgccatttctggt
gctggtaatgtcgccatctacgcgattcaaaaggttgaagcactcggtggcaaggtgatt
acctgctccgactcaaacggttacgttattgacgaaaacggtatcgacttcaagatcgtg
aagcagatcaaggaagttgaacgtggtcgcatcaaagactatgccgaccgtgtagccagt
gccagctattacgaaggttccgtctgggacgcccaagtagcttatgatatcgcgttacct
tgcgccacccaaaacgaaatcagcggtgatcaagccaagaacttgattgccaatggtgcc
aaggtcgttgccgaaggggctaacatgcctagcagtccagaagccattgcggcataccaa
gcttccagcttgctatatggtccggccaaagctgccaatgctggtggcgttgccgtttcc
gcccttgaaatgagccaaaatagtatgcgtttgagctggacttttgaagaagtcgataat
cgcctcaagcaaatcatgcaagatatctttgcacactccgttgccgctgccgacgaatac
cacgttagcggtgattacctgagtggtgctaacattgctggcttcacaaaagttgctgac
gccatgttagcgcaaggcttagtttaa

DBGET integrated database retrieval system