KEGG   Lactobacillus plantarum 16: Lp16_2776Help
Entry
Lp16_2776         CDS       T02698                                 

Definition
xylulose-5-phosphate phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Lp16_2776
Enzymes [BR:lpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Lp16_2776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2971832..2974222
Genome map
AA seq 796 aa AA seqDB search
MSEAIKSKTVDYSSDDYLKRVDAYWRAANYISVGQLYLLNNPLLREPLKATDVKVHPIGH
WGTIAGQNFIYAHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYPKITQDKA
GMKRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPGLIAATVVGDGE
SETGPLATSWQVNKFLNPITDGTVLPILNLNGFKISNPTVLSRESHEELEDYFKGLGWDP
HFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAKDNNDESRPKWPMIVFRAPKGWTGPKS
WDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLKPEIAAIIPEG
QARMAANPVTNGGKLTKDLITPNIDDYALDNKDHGKEDGSDMTELGKYIRDLIELNKDNK
NFRGWGPDETLSNKLGAAFEDTKRQWMEPIHEPNDALLAPQGRIIDSMLSEHMDEGMLEA
YNLTGRYGFFASYESFLRVVDSMLTQHFKWLRNSHEETPWRVDVPSLNVIASSTAFQQDH
NGYSHQDPGIISHLAEKKTEYVRAYLPGDANTLIATFDKAIQSKQLINLIIASKHPRPQW
FTMDEAKHLVRDGLGVVDWASTDNGEEPDVVFATAGSEPTTESLAAVSILHARFPEMKIR
FINVVDLLKLKKDDPRGLSDAEFDAFFTKDKPVIFAYHAYDDLVKTIFFDRHNHNLHVHG
YREEGDITTPFDMRVRNELDRFHLVKAALLATPAYAEKGAHVIQEMNSILNKHHDYIRAE
GTDLPEVENWKWTALK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcaattaaatccaaaacagttgattattcttctgatgactatctaaaacgc
gtcgatgcctattggcgcgctgctaactacatctcagttggtcaactctatctattaaat
aatccgttacttcgggaaccattaaaggcgaccgatgtaaaagtccatccaatcggtcat
tggggcacaattgccggccaaaactttatttatgcccatttgaaccgtgctattaacaag
tatgggctcaacatgttctacatcgaaggtcctggtcatggtggccaagtaatggtttct
aactcctacttagatggtacttatacggaaacgtatcctaaaatcacccaagacaaggcc
ggaatgaagcgcttattcaagcaattctcattcccaggtggtgttgcctcccacgccgac
cctaagacaccaggctcaatccacgaaggtggtgaacttggctactcaatcttgcatggt
gctggtgcggtcttagataaccctggtttaattgctgctactgttgttggtgatggtgaa
tctgaaactggcccattggcaacttcttggcaagttaacaagttcctcaacccaattaca
gacgggacagtcttaccaatcttgaacttaaacggcttcaagatttctaacccaacagtt
ctttcacgtgaatcacatgaagaacttgaagactactttaaaggtctaggctgggatcca
cactttgttgaaggtacagaccctgccaagatgcacaaaatcatggctgaagaattggat
aaagtcattgaagaaatccacgcaattcgtaagaacgccaaggataacaatgatgaatct
cgtcctaagtggccaatgattgttttccgggcacctaagggctggaccggtcctaagagt
tgggacggcgaaccaattgaaggttcattccgggctcaccaaattccaattcctgtcgat
cgcaatcacatggaacacgccgacaaattagttgactggctcaaatcatacaaaccagaa
gaattatttgatgaaaatggtactttaaaaccagaaattgccgcaatcatccctgaaggc
caagctcgtatggctgctaatcccgtcactaacggcggcaagttaactaaagacttaatt
acaccaaatatcgatgattatgctttggacaacaaggatcacggtaaggaagacggttca
gacatgactgaacttggtaagtatatccgtgatttaatcgaattaaacaaagataacaag
aacttccgcggttggggtcctgatgaaactttatctaacaaattaggagctgcgtttgaa
gataccaagcgtcaatggatggaaccaatccacgaacctaacgatgctttgttagcacct
caaggccggattattgactccatgttgtcagaacatatggatgaaggcatgttggaagct
tacaacttaactggtcgttacggcttctttgcaagttatgaatcattcctacgcgttgtg
gattcaatgttaacccaacatttcaagtggttacggaattctcacgaagaaacaccttgg
cgggttgatgtcccttcattaaacgtgattgcatcatcaactgccttccagcaagatcac
aatggttactctcaccaagatccaggtatcatctcacacttggctgaaaagaagaccgaa
tatgttcgggcctatctcccaggtgacgctaacaccttgattgcaacttttgataaggcg
atccaaagtaaacaattgattaacttgatcatcgccagcaagcatccccgtccacaatgg
tttacgatggacgaagctaagcatttagttcgtgatggcttaggtgtggttgattgggca
agtactgataatggtgaagaacccgacgttgtcttcgcaactgccggctctgaaccaacg
actgaaagtttagcggccgtatcaatcttgcacgctcgcttccctgaaatgaagattcgc
ttcattaacgttgtcgatcttctgaagttgaagaaggacgacccacggggcttatcagat
gctgaatttgatgccttcttcactaaagacaagccagttatctttgcataccatgcttac
gatgacttagtaaagaccatcttcttcgaccgtcataaccataacttacacgttcatggc
taccgcgaagaaggcgacattaccacgccattcgacatgcgtgttcgcaacgaactcgat
cgtttccacttagttaaagctgccttattagcaacgccagcctatgccgaaaaaggtgcc
catgtcatccaagagatgaacagcatcttaaacaagcatcatgactatatccgtgctgaa
ggtactgatcttccagaagttgaaaactggaaatggactgcattgaagtag

DBGET integrated database retrieval system