KEGG   Lactobacillus plantarum 16: Lp16_2793Help
Entry
Lp16_2793         CDS       T02698                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lp16_2793
  Amino acid metabolism
   00380 Tryptophan metabolism
    Lp16_2793
Enzymes [BR:lpz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Lp16_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2987780..2989102
Genome map
AA seq 440 aa AA seqDB search
MTEKLTTETGQPWANNEHSQTAGARGPVLMQDYNLLEKLAHFDRERIPERVVHAKGAGAK
GFFELENDMGEYTKADLFNGVGKKTPVILRFSQVAGEKGYPDTVRDVRGFALKFYTQQGN
YDLVGNNTPVFFVNDPLKFPDFIHSQKRDPKTNRRTQNMQWDFWAHSPESLHQVTYLMGD
RGLPASYRTMNGYGSHTFKWVNQNGEQFWVKYHFISDQGVKNMTAQAAEKAMSQDLDYLQ
DDLYDAIQEKNYPSWTMYVQILPYEEGLNYKWDIFDVTKVISHKDYPLIKVGKLTLNENP
TNNFTDIEEAAMSPANFVPGIEPSPDKLLQGRLFSYKDAQRYRLGANFEDLPVNKPVVPV
HNYERDGYMKINNQGAEVNYEPNALHGPEEVPDAALSPDSVRGETRAQPYRYQVDYTTQA
GDLYRLMSEPKQERLINGRL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaattaacgacggaaaccggccaaccatgggctaacaatgaacattcccaa
acggcaggagctcgtggtcccgtattaatgcaagactataatcttttggaaaaactagcc
cattttgatcgtgaacgaattccagaacgggtcgttcatgctaagggggccggagcaaaa
ggtttttttgaacttgaaaacgacatgggggaatatactaaggcagacttatttaatggt
gtcggtaagaaaactcccgtaatcttaaggttctcacaagttgccggtgaaaaaggttat
cctgacaccgttcgagacgtgcgcggttttgccttaaaattttatactcagcaaggcaat
tatgatctcgttggaaacaacacaccggtcttttttgtaaacgaccctttaaaatttcct
gacttcatccattcacaaaaacgggatcctaaaacgaaccgtcgtacgcaaaatatgcaa
tgggatttttgggctcattctccagaatcattgcaccaggtcacttatttaatgggcgac
cgaggtcttcctgcgtcctatcgaaccatgaatggttacggttcccatacttttaaatgg
gttaatcagaatggcgaacagttttgggttaagtatcacttcatctcagaccaaggcgtt
aaaaatatgactgctcaagcagctgaaaaagcaatgagccaagatttagattacttacaa
gatgacttatatgatgcaattcaagaaaaaaattacccatcatggacgatgtatgtccaa
atcttgccatatgaggaaggtctaaactataaatgggacatttttgatgtcactaaagtc
atctcccacaaagactatccactaattaaagtcggcaaactaactttaaatgagaatccc
actaataactttaccgatattgaagaggcggccatgtcgccagcaaattttgttcctggt
atcgaaccatctcccgacaaattactacaaggtcgcctattctcctataaagatgcacag
cgatatcggttaggtgccaactttgaagatttacccgtgaacaagccggttgttccagtt
cataattatgaacgtgatggttacatgaaaattaataatcaaggtgctgaggtcaactac
gagcctaatgcactgcatgggccagaagaggtgccggatgccgcactttcacctgattct
gttcgtggtgaaacacgcgcacagccttatcgctatcaagttgattacacaactcaagca
ggcgacctatatcgcttaatgtcagaacccaagcaagaacgcttaattaatggtagattg
taa

DBGET integrated database retrieval system