KEGG   Lactobacillus plantarum 16: Lp16_2819Help
Entry
Lp16_2819         CDS       T02698                                 

Definition
bifunctional protein: alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lp16_2819
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lp16_2819
   00620 Pyruvate metabolism
    Lp16_2819
   00650 Butanoate metabolism
    Lp16_2819
  Lipid metabolism
   00071 Fatty acid degradation
    Lp16_2819
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lp16_2819
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lp16_2819
   00626 Naphthalene degradation
    Lp16_2819
Enzymes [BR:lpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lp16_2819
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Lp16_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3018986..3021589)
Genome map
AA seq 867 aa AA seqDB search
MIKTEKNQTSKVTDEVDQLVQRSKKALAILKSYTQAQIDDLCEKVAVAALDNHMKLAKLA
VEETGRGVVEDKAIKNIYASEYIWNSMRHDKTVGVIKEDDEEQLMEIAEPVGIVAGVTPV
TNPTSTTVFKTLISLKGRNTIVFGFHPQAQKCSSAAADVMREAIKAAGGPADAVLYIEHP
SIEATDALMHHTDVATILATGGPSMVTAAYSSGKPALGVGPGNGPTYVEKTADIKQAVND
IVLSKTFDNGMICASENSAIIDKEIYAEVKAEFIRLGCYYVKPKDVQALSDAVIDPNRHT
VRGPVAGKTAYQIAQMAGLKDVAKDCRVLIAEINGVGIKYPLSGEKLSPVLTVYKADSHE
AAFKRANELLHYGGLGHTAGIHTTDDALVKEFGLQMPACRILVNTPSSVGGLGNIYNNMA
PSLTLGTGSYGGNSISHNVTDMDLINIKTVAKRRNNMQWVKMPPKVYFERNSVRYLEHMA
GIKKVFLVCDPGMVEFGYADRVTAVLNKRTDPVDIDIFSEVEPNPSTDTVYKGVARMKAF
KPDTIIALGGGSAMDAAKGMWLFYEHPEASFLGAKQKFLDIRKRTYKVPVSEKVTYIGIP
TTSGTGSEVTPYAVITDSKTHVKYPITDYAMQPDIAIVDPQFVETVPKRTTAWTGLDVIT
HATEAYVSTMASDFTRGWSIQALQLAFKYLKASYDGDKMAREKMHNASTLAGMAFANAFL
GINHSIAHKLGGEFNLPHGLAIAITYPQVVRYNAEIPTKLAMWPKYNHNTALADYANIAR
ALGLPGKTDEELKESLVKAYIDLAHSMDVTLSLKANRVEKKHFDATVDELAELAYEDQCT
TANPREPLISELKAIIEREWDGQGTEK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacagaaaaaaatcaaacaagcaaagttactgacgaagttgatcaattagtt
caacgttctaagaaagcattagctattttgaagtcatatacccaagcacaaatcgatgat
ttatgtgaaaaggttgcggttgccgcactggacaatcatatgaagttagccaagttggcg
gttgaggaaaccggtcggggtgttgttgaagataaggcgattaagaacatctacgccagc
gaatatatctggaacagcatgcgccatgataagacagtcggcgtcattaaagaagacgat
gaagagcaactaatggaaattgctgaaccagttggtatcgtagccggggttacacccgta
acgaatccaacttcaacaacggttttcaagacgttgatctcattaaaggggcgtaacacg
atcgtctttggtttccatcctcaagctcagaaatgtagttctgcggctgctgatgtgatg
cgggaagcgattaaagctgctggtggtccagctgatgctgttttatacatcgaacaccca
agcattgaagcaaccgacgccttgatgcaccatacggatgttgcgacgatcttggctacc
ggtggtccaagtatggtgacagccgcttactcatcaggtaaaccagcactgggtgttggt
cctggtaacggcccaacttatgttgaaaaaacagctgacattaagcaggcggttaacgac
attgttttatcgaagacgtttgataatgggatgatttgtgcttctgaaaatagtgccatt
atcgacaaggaaatttatgctgaagttaaagctgaatttattcgtttgggttgctactac
gttaaacctaaagatgtgcaagccttgagtgatgctgtcattgatcctaaccggcacaca
gttcgtggtccagttgctggtaaaacagcttatcaaatcgcacaaatggctggcttgaaa
gatgtcgctaaggactgccgggtcttgattgcggagattaatggtgtcggtatcaagtac
ccattatccggcgaaaaattatcaccagttctgaccgtttacaaagcggattcgcatgaa
gcggcgttcaaacgggctaatgaattacttcactatggtggcttaggccatactgctggg
attcatacgaccgatgatgcattggtcaaagaatttggcttacaaatgccagcttgccgg
atcttagttaacacgccatcttcagttggtgggttaggtaacatctacaataacatggcg
ccttcattaactctgggcacgggatcatatggtggcaactcgatttctcataacgttaca
gatatggatctgattaatatcaaaactgtggcaaaacggcgtaataacatgcaatgggtc
aaaatgcctcccaaagtctacttcgaacgcaattccgttcgctacttggaacacatggcc
gggattaagaaggttttcctagtttgtgatcctgggatggttgaatttggctatgctgat
cgagtaacggcggtcttgaacaagcggactgatccggttgatatcgacatcttctcagaa
gttgaaccgaacccgtcgactgacacagtctacaaaggggttgcccggatgaaggccttt
aagccagatacaatcattgcactcggtggtggttctgcaatggacgccgctaaggggatg
tggctcttctatgaacacccagaagcttccttcttaggtgctaaacagaagttcctggat
atccggaagcggacgtacaaagtaccagtatctgaaaaagtaacttatattgggattcca
acgacttctgggactggttctgaagtaacgccatacgcggttattacggactccaagacg
cacgtcaaatacccgattacggactacgcaatgcaaccagatattgcgatcgttgaccca
caatttgttgaaacggtgccaaagcggacgacggcttggactggtctcgacgtaattacc
cacgcaaccgaagcatatgtttcaacgatggcttctgacttcacacgcggctggtcaatt
caagctttgcaattagccttcaagtacttgaaagcttcttatgatggtgacaagatggct
cgtgagaagatgcacaatgcctcaacgctagctgggatggcctttgccaatgccttcttg
ggtatcaaccactcgatcgcccataaattaggcggggaattcaacttaccacacggattg
gcaattgcgatcacgtatccgcaagtcgttcgttacaatgctgaaatcccaacgaagtta
gcaatgtggccgaagtacaaccataatactgccttagccgactatgccaacattgcccgg
gccttagggttaccaggcaagaccgacgaagaactcaaagaaagcttagttaaagcttac
attgacttggctcactcaatggatgtgaccttatccttgaaagccaaccgggtcgaaaag
aagcactttgacgccaccgtcgacgaattagccgaactggcctatgaagaccaatgcacg
accgctaacccacgcgaacctttaatcagtgaattaaaggcgattattgaacgtgaatgg
gacggccaaggtactgaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system