KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_104Help
Entry
LRHK_104          CDS       T01961                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase family protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lra00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108718..109308
Genome map
AA seq 196 aa AA seqDB search
MTLEVVPFSSASSEIDGLKIIHVKMVTDERGTVRELFRQSQHSQVLVNPNMAWKQVNLTR
TKRGAVRGLHGEAMSKLVTVAHGEAFGAYVDTRRDSPTLGSVVTVRLTPGVQVFVPQGVC
NGFQAVADDTEYLYFFDNEWEKGMSGVALTPLDPDLGIEWPIAIKPDNLAQISKKDSEAP
TLKEVLKQLAETRPKE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaagttgttcctttttcatccgcatcatccgaaattgatgggttgaagatt
attcatgtgaagatggtgacggatgagcgcggaacggttcgagagctgtttcgccagagc
cagcattcgcaagtgttagtaaaccctaatatggcttggaaacaggtcaatttgacccgg
actaagcgcggggctgttagagggttgcatggtgaagcgatgtcgaagctcgtcacggtt
gcccatggagaagcatttggtgcctatgtggatacaagacgggacagtcctactttgggt
tccgttgtcacggttcgtttaacgcccggtgtgcaggtttttgttcctcaaggcgtttgt
aatgggtttcaggcggttgccgatgatacggaatatctttacttcttcgacaacgaatgg
gaaaaggggatgagcggtgtggcactaacacctctggatcctgatttggggattgagtgg
ccgatcgccattaagcctgataatttagcgcaaatttcaaaaaaagattccgaggcgcct
actttgaaggaagtgctgaaacaactggcagagacgcggccaaaggaataa

DBGET integrated database retrieval system