KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_104Help
Entry
LRHK_104          CDS       T01961                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase family protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LRHK_104
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LRHK_104
Enzymes [BR:lra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LRHK_104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108718..109308
Genome map
AA seq 196 aa AA seqDB search
MTLEVVPFSSASSEIDGLKIIHVKMVTDERGTVRELFRQSQHSQVLVNPNMAWKQVNLTR
TKRGAVRGLHGEAMSKLVTVAHGEAFGAYVDTRRDSPTLGSVVTVRLTPGVQVFVPQGVC
NGFQAVADDTEYLYFFDNEWEKGMSGVALTPLDPDLGIEWPIAIKPDNLAQISKKDSEAP
TLKEVLKQLAETRPKE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaagttgttcctttttcatccgcatcatccgaaattgatgggttgaagatt
attcatgtgaagatggtgacggatgagcgcggaacggttcgagagctgtttcgccagagc
cagcattcgcaagtgttagtaaaccctaatatggcttggaaacaggtcaatttgacccgg
actaagcgcggggctgttagagggttgcatggtgaagcgatgtcgaagctcgtcacggtt
gcccatggagaagcatttggtgcctatgtggatacaagacgggacagtcctactttgggt
tccgttgtcacggttcgtttaacgcccggtgtgcaggtttttgttcctcaaggcgtttgt
aatgggtttcaggcggttgccgatgatacggaatatctttacttcttcgacaacgaatgg
gaaaaggggatgagcggtgtggcactaacacctctggatcctgatttggggattgagtgg
ccgatcgccattaagcctgataatttagcgcaaatttcaaaaaaagattccgaggcgcct
actttgaaggaagtgctgaaacaactggcagagacgcggccaaaggaataa

DBGET integrated database retrieval system