KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1040Help
Entry
LRHK_1040         CDS       T01961                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00052  Galactose metabolism
lra00561  Glycerolipid metabolism
lra00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LRHK_1040
  Lipid metabolism
   00561 Glycerolipid metabolism
    LRHK_1040
   00600 Sphingolipid metabolism
    LRHK_1040
Enzymes [BR:lra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LRHK_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 DRE2_N
Motif
Other DBs
NCBI-ProteinID: AER63829
Position
990120..992414
Genome map
AA seq 764 aa AA seqDB search
MIDVTDDHAFHLYNQKISYICALLPNGQLGHLYFGPRLSLTTADLTYLSQGSSPFAWMAN
FSDDQPFALGDAQQEYPVYGTGDFRQGSLSVTQADAPVYPNFVFKDYQVSHTKMRDLHHP
TSFGNPALTDILTIHLEDETAQLLLTLQYTIFSDSATVVRVATLTNQGAEPVMIERMLSG
ALNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AVGDAYGANLVYSGNFLDSIEVNEWDQTRLLAGIHPASFSWRLDPKTSFTTPEVVLSFSS
AGLAGLSQVNQRFVARHIIDPQWRQKPRPVVLNSWEATYFDLNEQKLLHLAKLGRQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAEEIHGLGLQFGLWFEPEMVSPRS
QFFKEHPDWVVRPKRGRMSITRHQYVLDFSNPAVVNNIFAQMQRVITETKLDYVKWDLNR
SITEAYSPYLAKIGHPQGEFFHRYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAIPNEQVGRSTPLATRFRVAAFG
ILGYELDLTKLDDAALAAIKNQIAYYHELQPLVLNGDFRLLLPRQSNSQNQVAWLLSDHS
RKRLVLGFFRVLADADSRAVQYMKIPVAQPNQRYWVNGHTGPVSGDVLQRVGVRLPIQFN
GANRQQAQLIGDYQSALLTFDGVTATKTGKHQPETRKQQKVGHA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatgttactgacgatcatgcttttcatttatataatcaaaagatcagctatatt
tgtgcgttattgccaaatggtcagttgggccatctctattttggcccaagattatcgttg
acgactgctgatttgacctatctatcgcaaggttccagtccgtttgcgtggatggctaac
ttttccgacgatcagccgtttgcattaggtgatgcgcaacaggagtatccggtttatgga
actggcgattttcggcaaggcagtttaagtgtgacccaagcagacgcacccgtgtatccg
aattttgtgtttaaagattatcaggtgagtcacaccaaaatgcgggatttgcatcatcca
acgagctttggtaatccagccctgaccgatattttgacaattcaccttgaagatgaaacg
gcgcagttattattaacgctgcagtatacgattttttcggatagtgccacggtcgttcgg
gtagctactttgacgaaccaaggtgctgagccggttatgattgagcggatgttgagcggg
gcgctgaatttaccccaaggccgttatgatgttgttcacttgtcaggtaactgggccaaa
gagcggcatattcagacacagcctttgacgcaaggaacgttttcagtggaatctttgcgc
ggggcatcgagtcatgaacaaaatccgttcgtcgcattgcacgcagccggacaacccttt
gctgttggcgatgcttacggtgcgaacttagtctattcggggaactttctggatagcatt
gaagttaatgaatgggatcagacgcggcttttggctggcattcatccggcttcttttagc
tggcgactagatccgaaaaccagttttactacccctgaagtggtcttaagctttagttca
gcgggactagctggtttatcccaagtcaatcagcgttttgtggcccggcatattattgac
ccgcaatggcgccaaaagccgcgtccggttgttttgaacagttgggaagcgacctatttt
gacttgaatgaacaaaagttgctgcatctggctaaattgggacgtcaggtgggggttgac
tgttttgttcttgatgatggctggtttggtacccgtgataatgatttaagttcattgggg
gattggttcacaaataagcataagtttccggatggcttagggcattttgctgaggaaatt
catggcctcggccttcagtttggcctgtggtttgaaccggaaatggtatcgcctcgatcg
caatttttcaaggaacatccggattgggtggtccgtcccaagcgcggccgaatgtcgatc
acgcgtcatcaatatgttctggactttagtaatccagcggtcgtgaataatatttttgcg
caaatgcaacgcgttattaccgaaaccaagcttgattatgtgaagtgggatctcaatcgc
agtattaccgaagcctattcaccctacctggcaaaaattgggcatcctcaaggtgaattc
ttccatcgctatgtacaaggcgtctataccctctatcaaaagctgctcacggcctttccc
cacctgctgattgaaggctgtgctggtggtggcgggcgctttgatttggggattctcttt
tatagtccgcaaatctggaccagtgatgattctgatgcgatcgaacggttggcaattcaa
tcaggaaccgcactggcttatccgttaagttgtatgagcaatcacgtgacggcgataccg
aatgaacaagtcggacgctccacaccgttggctacgcgatttcgtgtggcagcatttggc
attctcggctatgaattggatttaaccaaactggatgatgcggcattggcagcaatcaaa
aaccaaattgcttattatcatgaattacaaccattagtcttaaatggtgattttcggctg
cttttgccacgtcaatccaacagccagaatcaagtagcatggctgctaagcgatcattcc
cgcaagcgtttagtcttaggcttcttccgcgtccttgccgatgcagacagccgcgccgtg
cagtatatgaagataccggttgcccagccaaaccaacgttattgggtaaacggtcacact
gggccggtttccggtgatgtcttgcagcgggttggcgttcgcttaccgatccaattcaat
ggcgctaaccggcaacaagcccaattgatcggtgactatcaatcggccttattgactttt
gacggggtgacagcaaccaaaaccggcaagcatcaacctgagactcgcaagcagcagaag
gttggacatgcttga

DBGET integrated database retrieval system