KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1054Help
Entry
LRHK_1054         CDS       T01961                                 

Definition
GDSL-like Lipase/Acylhydrolase family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LRHK_1054
Enzymes [BR:lra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LRHK_1054
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LRHK_1054
Lipid biosynthesis proteins [BR:lra01004]
 Fatty acid synthase
  Component type
   LRHK_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1001956..1002738)
Genome map
AA seq 260 aa AA seqDB search
MKKIWLGLGVLLLLLAAGCGVSRQAAKSSRSSAPVRSRQASAASTPPRPTRLAQLKAKSK
TQLVYAPFGDSLSVGLFADKKATRFTSLFARQLARLTSKTVTEAGIAEVGKTATNLGVPA
LPQLIAQHPDVITIEFGTNDAVGGATPTALAAYQQALTTIVTTLQKETSAQLILMTTWSP
NQGPYVNADLKFDAVVKAVGQTYQVPVVDLATIWQGHDDVTGPAGTVIPDFTANGPRDTF
HPNQRGHDQIAAQLIKTLEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttggttgggattgggtgttttactattgttgctagcggctggctgtggg
gtttcgcggcaagctgctaagtcaagccgctcctctgcgccagttcgcagtcggcaggcc
agcgccgcttcaacgccgccgcgcccgacccgactggcgcaattgaaggccaaaagcaaa
acacagttagtttatgctccttttggcgacagtctttcagttggcctttttgccgataaa
aaagccactcgttttacatcgctttttgcccggcagctggcccgattaaccagcaaaacc
gtcaccgaggccggcattgcggaagtgggaaaaacggctactaacttgggcgtccccgct
ttaccgcaactcattgctcagcatccggatgtgatcactattgagtttggcaccaatgac
gctgtcggtggcgcaaccccaactgcgctcgctgcctatcaacaagcactgacaaccatt
gtcaccacgttgcaaaaagaaacctcggcacaactgatcctcatgacaacctggtcacca
aatcaagggccctacgttaatgccgacttgaaattcgatgccgttgttaaagcagtgggg
caaacctaccaggtaccggtcgttgacttggcaaccatctggcaaggtcatgatgatgtc
accggaccggctggcactgtcattccggatttcactgccaatggcccccgggatacgttc
caccctaatcaacgcggccatgatcaaattgctgctcaactcattaaaactttggaggaa
tga

DBGET integrated database retrieval system