KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1097Help
Entry
LRHK_1097         CDS       T01961                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LRHK_1097 (galU)
   00052 Galactose metabolism
    LRHK_1097 (galU)
   00500 Starch and sucrose metabolism
    LRHK_1097 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LRHK_1097 (galU)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LRHK_1097 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043800..1044714
Genome map
AA seq 304 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQK
RSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSF
VGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKEVS
KDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTLNQ
TQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGKHVGKP
ANKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctgccagca
accaaagctttagctaaggaaatgttgccgattgtcgacaaaccaaccattcaatttatc
gttgaagaagctaaggctagtgggattgaggatattctgattgttgagggtaaacaaaaa
cgctctattgaagatcattttgactcagcacctgagttggaacagaatctgaaagaaaaa
cataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaacttattc
ttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaatcgttt
gttggcgacgaaccattcgtggtcatgttgggtgatgacctgatgaatgacaaagtgccg
ttgaccaagcaattaattgatgaatatgataaaacccatgcgtccattcttgccgttaaa
aaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaagtttcc
aaagacctctataacgttaagaaattcgttgaaaagcccgctgttgctgatgccccaagt
gacttggctatcatcggccgctacctgctgaccccggaaatctttgatattcttgataat
caaaaaccgggcaaaggcaatgaaattcagttaaccgatgcgattgataccttgaaccaa
actcagcgcgtctttgcacatgagtttaaaggggatcgctacgatgtcggcaataagttc
gggtacgtcaagactaatgttgaatatggcttgacccatccggaagtaaaagatgaactc
cgcgcatacatccttgatctggctgctaagttgcaatcaggcaagcatgtggggaagccg
gcaaataagaagtaa

DBGET integrated database retrieval system